Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 1604369..1605048 | Replicon | chromosome |
| Accession | NZ_CP104848 | ||
| Organism | Escherichia coli strain DFK.1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | N7218_RS07900 | Protein ID | WP_000057523.1 |
| Coordinates | 1604369..1604671 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | N7218_RS07905 | Protein ID | WP_000806442.1 |
| Coordinates | 1604707..1605048 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7218_RS07875 (1599745) | 1599745..1601397 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| N7218_RS07880 (1601435) | 1601435..1601938 | - | 504 | WP_000667000.1 | hypothetical protein | - |
| N7218_RS07885 (1601935) | 1601935..1602735 | - | 801 | WP_000439798.1 | hypothetical protein | - |
| N7218_RS07890 (1602759) | 1602759..1603238 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| N7218_RS07895 (1603442) | 1603442..1604236 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| N7218_RS07900 (1604369) | 1604369..1604671 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7218_RS07905 (1604707) | 1604707..1605048 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| N7218_RS07910 (1605106) | 1605106..1607610 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| N7218_RS07915 (1607872) | 1607872..1608804 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T259297 WP_000057523.1 NZ_CP104848:1604369-1604671 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|