Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 56163..56405 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104847 | ||
| Organism | Escherichia coli strain DFS.1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | N7219_RS24580 | Protein ID | WP_001372321.1 |
| Coordinates | 56280..56405 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 56163..56203 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7219_RS24555 (51358) | 51358..53316 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
| N7219_RS24560 (53371) | 53371..53805 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| N7219_RS24565 (53802) | 53802..54564 | + | 763 | Protein_76 | plasmid SOS inhibition protein A | - |
| - (54533) | 54533..54719 | + | 187 | NuclAT_0 | - | - |
| - (54533) | 54533..54719 | + | 187 | NuclAT_0 | - | - |
| - (54533) | 54533..54719 | + | 187 | NuclAT_0 | - | - |
| - (54533) | 54533..54719 | + | 187 | NuclAT_0 | - | - |
| N7219_RS24570 (54767) | 54767..56136 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - (56163) | 56163..56203 | + | 41 | NuclAT_1 | - | Antitoxin |
| - (56163) | 56163..56203 | + | 41 | NuclAT_1 | - | Antitoxin |
| - (56163) | 56163..56203 | + | 41 | NuclAT_1 | - | Antitoxin |
| - (56163) | 56163..56203 | + | 41 | NuclAT_1 | - | Antitoxin |
| N7219_RS24575 (56189) | 56189..56338 | + | 150 | Protein_78 | plasmid maintenance protein Mok | - |
| N7219_RS24580 (56280) | 56280..56405 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| N7219_RS24585 (56625) | 56625..56855 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| N7219_RS24590 (56853) | 56853..57026 | - | 174 | Protein_81 | hypothetical protein | - |
| N7219_RS24595 (57096) | 57096..57302 | + | 207 | WP_024261895.1 | hypothetical protein | - |
| N7219_RS24600 (57327) | 57327..57614 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| N7219_RS24605 (57733) | 57733..58554 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| N7219_RS24610 (58851) | 58851..59453 | - | 603 | WP_260654181.1 | transglycosylase SLT domain-containing protein | - |
| N7219_RS24615 (59784) | 59784..60167 | + | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| N7219_RS24620 (60301) | 60301..60978 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| N7219_RS24625 (61066) | 61066..61293 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaTEM-1B | - | 1..92732 | 92732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T259284 WP_001372321.1 NZ_CP104847:56280-56405 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 41 bp
>AT259284 NZ_CP104847:56163-56203 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
