Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 5229..5468 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104847 | ||
| Organism | Escherichia coli strain DFS.1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | N7219_RS24225 | Protein ID | WP_023144756.1 |
| Coordinates | 5334..5468 (+) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 5229..5289 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7219_RS24195 (1025) | 1025..1585 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| N7219_RS24200 (1716) | 1716..1927 | + | 212 | Protein_3 | hypothetical protein | - |
| N7219_RS24205 (2618) | 2618..2908 | + | 291 | WP_261631932.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| N7219_RS24210 (2905) | 2905..3254 | + | 350 | Protein_5 | IS66 family insertion sequence element accessory protein TnpB | - |
| N7219_RS24215 (3285) | 3285..4898 | + | 1614 | Protein_6 | IS66-like element ISEc23 family transposase | - |
| N7219_RS24220 (4976) | 4976..5262 | + | 287 | Protein_7 | DUF2726 domain-containing protein | - |
| - (5229) | 5229..5289 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (5229) | 5229..5289 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (5229) | 5229..5289 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (5229) | 5229..5289 | - | 61 | NuclAT_2 | - | Antitoxin |
| N7219_RS24225 (5334) | 5334..5468 | + | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| N7219_RS24230 (5764) | 5764..6018 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| N7219_RS24235 (6124) | 6124..6255 | + | 132 | Protein_10 | protein CopA/IncA | - |
| N7219_RS24240 (6255) | 6255..6329 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| N7219_RS24245 (6322) | 6322..7179 | + | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| N7219_RS24250 (8119) | 8119..8679 | + | 561 | WP_261631931.1 | CPBP family intramembrane metalloprotease | - |
| N7219_RS24255 (8864) | 8864..9121 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| N7219_RS24260 (9054) | 9054..9455 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaTEM-1B | - | 1..92732 | 92732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T259278 WP_023144756.1 NZ_CP104847:5334-5468 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT259278 NZ_CP104847:c5289-5229 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
