Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4734686..4735288 | Replicon | chromosome |
| Accession | NZ_CP104846 | ||
| Organism | Escherichia coli strain DFS.1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | N7219_RS23170 | Protein ID | WP_000897302.1 |
| Coordinates | 4734977..4735288 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N7219_RS23165 | Protein ID | WP_000356397.1 |
| Coordinates | 4734686..4734976 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7219_RS23135 (4729993) | 4729993..4730922 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
| N7219_RS23140 (4731104) | 4731104..4731346 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| N7219_RS23145 (4731636) | 4731636..4732484 | + | 849 | WP_001038650.1 | hypothetical protein | - |
| N7219_RS23150 (4732509) | 4732509..4733249 | + | 741 | WP_000608806.1 | hypothetical protein | - |
| N7219_RS23155 (4733434) | 4733434..4733652 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| N7219_RS23160 (4734049) | 4734049..4734327 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| N7219_RS23165 (4734686) | 4734686..4734976 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| N7219_RS23170 (4734977) | 4734977..4735288 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| N7219_RS23175 (4735517) | 4735517..4736425 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| N7219_RS23180 (4736489) | 4736489..4737430 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| N7219_RS23185 (4737475) | 4737475..4737912 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| N7219_RS23190 (4737909) | 4737909..4738781 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| N7219_RS23195 (4738775) | 4738775..4739374 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T259277 WP_000897302.1 NZ_CP104846:c4735288-4734977 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|