Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2336412..2336633 Replicon chromosome
Accession NZ_CP104846
Organism Escherichia coli strain DFS.1

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag N7219_RS11645 Protein ID WP_001531632.1
Coordinates 2336412..2336519 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2336567..2336633 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7219_RS11620 (2332256) 2332256..2333338 + 1083 WP_000804726.1 peptide chain release factor 1 -
N7219_RS11625 (2333338) 2333338..2334171 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
N7219_RS11630 (2334168) 2334168..2334560 + 393 WP_000200375.1 invasion regulator SirB2 -
N7219_RS11635 (2334564) 2334564..2335373 + 810 WP_001257044.1 invasion regulator SirB1 -
N7219_RS11640 (2335409) 2335409..2336263 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
N7219_RS11645 (2336412) 2336412..2336519 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2336569) 2336569..2336632 + 64 NuclAT_12 - -
- (2336569) 2336569..2336632 + 64 NuclAT_12 - -
- (2336569) 2336569..2336632 + 64 NuclAT_12 - -
- (2336569) 2336569..2336632 + 64 NuclAT_12 - -
- (2336569) 2336569..2336632 + 64 NuclAT_13 - -
- (2336569) 2336569..2336632 + 64 NuclAT_13 - -
- (2336569) 2336569..2336632 + 64 NuclAT_13 - -
- (2336569) 2336569..2336632 + 64 NuclAT_13 - -
- (2336569) 2336569..2336632 + 64 NuclAT_14 - -
- (2336569) 2336569..2336632 + 64 NuclAT_14 - -
- (2336569) 2336569..2336632 + 64 NuclAT_14 - -
- (2336569) 2336569..2336632 + 64 NuclAT_14 - -
- (2336569) 2336569..2336632 + 64 NuclAT_15 - -
- (2336569) 2336569..2336632 + 64 NuclAT_15 - -
- (2336569) 2336569..2336632 + 64 NuclAT_15 - -
- (2336569) 2336569..2336632 + 64 NuclAT_15 - -
- (2336569) 2336569..2336632 + 64 NuclAT_16 - -
- (2336569) 2336569..2336632 + 64 NuclAT_16 - -
- (2336569) 2336569..2336632 + 64 NuclAT_16 - -
- (2336569) 2336569..2336632 + 64 NuclAT_16 - -
- (2336569) 2336569..2336632 + 64 NuclAT_17 - -
- (2336569) 2336569..2336632 + 64 NuclAT_17 - -
- (2336569) 2336569..2336632 + 64 NuclAT_17 - -
- (2336569) 2336569..2336632 + 64 NuclAT_17 - -
- (2336567) 2336567..2336633 + 67 NuclAT_10 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_10 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_10 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_10 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_5 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_5 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_5 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_5 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_6 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_6 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_6 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_6 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_7 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_7 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_7 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_7 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_8 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_8 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_8 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_8 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_9 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_9 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_9 - Antitoxin
- (2336567) 2336567..2336633 + 67 NuclAT_9 - Antitoxin
- (2336569) 2336569..2336634 + 66 NuclAT_18 - -
- (2336569) 2336569..2336634 + 66 NuclAT_18 - -
- (2336569) 2336569..2336634 + 66 NuclAT_18 - -
- (2336569) 2336569..2336634 + 66 NuclAT_18 - -
- (2336569) 2336569..2336634 + 66 NuclAT_19 - -
- (2336569) 2336569..2336634 + 66 NuclAT_19 - -
- (2336569) 2336569..2336634 + 66 NuclAT_19 - -
- (2336569) 2336569..2336634 + 66 NuclAT_19 - -
- (2336569) 2336569..2336634 + 66 NuclAT_20 - -
- (2336569) 2336569..2336634 + 66 NuclAT_20 - -
- (2336569) 2336569..2336634 + 66 NuclAT_20 - -
- (2336569) 2336569..2336634 + 66 NuclAT_20 - -
- (2336569) 2336569..2336634 + 66 NuclAT_21 - -
- (2336569) 2336569..2336634 + 66 NuclAT_21 - -
- (2336569) 2336569..2336634 + 66 NuclAT_21 - -
- (2336569) 2336569..2336634 + 66 NuclAT_21 - -
- (2336569) 2336569..2336634 + 66 NuclAT_22 - -
- (2336569) 2336569..2336634 + 66 NuclAT_22 - -
- (2336569) 2336569..2336634 + 66 NuclAT_22 - -
- (2336569) 2336569..2336634 + 66 NuclAT_22 - -
- (2336569) 2336569..2336634 + 66 NuclAT_23 - -
- (2336569) 2336569..2336634 + 66 NuclAT_23 - -
- (2336569) 2336569..2336634 + 66 NuclAT_23 - -
- (2336569) 2336569..2336634 + 66 NuclAT_23 - -
N7219_RS11650 (2336924) 2336924..2338024 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
N7219_RS11655 (2338294) 2338294..2338533 + 240 WP_000120702.1 putative cation transport regulator ChaB -
N7219_RS11660 (2338682) 2338682..2339377 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
N7219_RS11665 (2339421) 2339421..2339774 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
N7219_RS11670 (2339959) 2339959..2341353 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T259263 WP_001531632.1 NZ_CP104846:c2336519-2336412 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT259263 NZ_CP104846:2336567-2336633 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References