Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 1485048..1485727 | Replicon | chromosome |
| Accession | NZ_CP104846 | ||
| Organism | Escherichia coli strain DFS.1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | N7219_RS07255 | Protein ID | WP_000057523.1 |
| Coordinates | 1485048..1485350 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | N7219_RS07260 | Protein ID | WP_000806442.1 |
| Coordinates | 1485386..1485727 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7219_RS07230 (1480424) | 1480424..1482076 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| N7219_RS07235 (1482114) | 1482114..1482617 | - | 504 | WP_000667000.1 | hypothetical protein | - |
| N7219_RS07240 (1482614) | 1482614..1483414 | - | 801 | WP_000439798.1 | hypothetical protein | - |
| N7219_RS07245 (1483438) | 1483438..1483917 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| N7219_RS07250 (1484121) | 1484121..1484915 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| N7219_RS07255 (1485048) | 1485048..1485350 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7219_RS07260 (1485386) | 1485386..1485727 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| N7219_RS07265 (1485785) | 1485785..1488289 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| N7219_RS07270 (1488551) | 1488551..1489483 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T259262 WP_000057523.1 NZ_CP104846:1485048-1485350 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|