Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4858172..4858774 | Replicon | chromosome |
Accession | NZ_CP104843 | ||
Organism | Escherichia coli strain DFL.5 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | N7217_RS23570 | Protein ID | WP_000897305.1 |
Coordinates | 4858463..4858774 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N7217_RS23565 | Protein ID | WP_000356397.1 |
Coordinates | 4858172..4858462 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7217_RS23545 (4854674) | 4854674..4855576 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
N7217_RS23550 (4855573) | 4855573..4856208 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
N7217_RS23555 (4856205) | 4856205..4857134 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
N7217_RS23560 (4857349) | 4857349..4857567 | - | 219 | WP_001298592.1 | CopG family transcriptional regulator | - |
N7217_RS23565 (4858172) | 4858172..4858462 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
N7217_RS23570 (4858463) | 4858463..4858774 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
N7217_RS23575 (4859003) | 4859003..4859911 | + | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
N7217_RS23580 (4859975) | 4859975..4860916 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
N7217_RS23585 (4860961) | 4860961..4861398 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
N7217_RS23590 (4861395) | 4861395..4862267 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
N7217_RS23595 (4862261) | 4862261..4862860 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
N7217_RS23600 (4862959) | 4862959..4863744 | - | 786 | WP_000059679.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T259250 WP_000897305.1 NZ_CP104843:c4858774-4858463 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|