Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3908265..3908959 | Replicon | chromosome |
| Accession | NZ_CP104843 | ||
| Organism | Escherichia coli strain DFL.5 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | N7217_RS18965 | Protein ID | WP_001263491.1 |
| Coordinates | 3908265..3908663 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | N7217_RS18970 | Protein ID | WP_000554755.1 |
| Coordinates | 3908666..3908959 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7217_RS18935 (3903527) | 3903527..3904984 | + | 1458 | WP_022645227.1 | cytosol nonspecific dipeptidase | - |
| N7217_RS18940 (3904993) | 3904993..3905274 | + | 282 | WP_022645226.1 | hypothetical protein | - |
| N7217_RS18945 (3905291) | 3905291..3905800 | - | 510 | WP_001361775.1 | metal-dependent hydrolase | - |
| N7217_RS18950 (3905862) | 3905862..3906476 | - | 615 | WP_022645225.1 | peptide chain release factor H | - |
| N7217_RS18955 (3906473) | 3906473..3907612 | - | 1140 | WP_022645224.1 | RNA ligase RtcB family protein | - |
| N7217_RS18960 (3907803) | 3907803..3908255 | - | 453 | WP_023909048.1 | GNAT family N-acetyltransferase | - |
| N7217_RS18965 (3908265) | 3908265..3908663 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| N7217_RS18970 (3908666) | 3908666..3908959 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N7217_RS18975 (3909011) | 3909011..3910066 | - | 1056 | WP_022645222.1 | DNA polymerase IV | - |
| N7217_RS18980 (3910137) | 3910137..3910922 | - | 786 | WP_072224360.1 | putative lateral flagellar export/assembly protein LafU | - |
| N7217_RS18985 (3910894) | 3910894..3912606 | + | 1713 | Protein_3720 | flagellar biosynthesis protein FlhA | - |
| N7217_RS18990 (3912704) | 3912704..3913477 | - | 774 | WP_022645219.1 | C40 family peptidase | - |
| N7217_RS18995 (3913663) | 3913663..3913923 | + | 261 | WP_000729708.1 | type II toxin-antitoxin system antitoxin DinJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T259243 WP_001263491.1 NZ_CP104843:c3908663-3908265 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |