Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3708094..3708773 | Replicon | chromosome |
Accession | NZ_CP104843 | ||
Organism | Escherichia coli strain DFL.5 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0A1A1R1 |
Locus tag | N7217_RS18020 | Protein ID | WP_000057541.1 |
Coordinates | 3708471..3708773 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | N7217_RS18015 | Protein ID | WP_000806442.1 |
Coordinates | 3708094..3708435 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7217_RS18005 (3704337) | 3704337..3705269 | - | 933 | WP_022645289.1 | glutaminase A | - |
N7217_RS18010 (3705532) | 3705532..3708036 | + | 2505 | WP_038431953.1 | copper-exporting P-type ATPase CopA | - |
N7217_RS18015 (3708094) | 3708094..3708435 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
N7217_RS18020 (3708471) | 3708471..3708773 | - | 303 | WP_000057541.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7217_RS18025 (3708906) | 3708906..3709700 | + | 795 | WP_022645287.1 | TraB/GumN family protein | - |
N7217_RS18030 (3709904) | 3709904..3710383 | + | 480 | WP_000186638.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
N7217_RS18035 (3710420) | 3710420..3712072 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
N7217_RS18040 (3712290) | 3712290..3713510 | + | 1221 | WP_022645286.1 | fosmidomycin MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11795.37 Da Isoelectric Point: 10.2638
>T259241 WP_000057541.1 NZ_CP104843:c3708773-3708471 [Escherichia coli]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A1A1R1 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2EBY | |
AlphaFold DB | S1QAY3 |