Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 661444..662243 | Replicon | chromosome |
| Accession | NZ_CP104843 | ||
| Organism | Escherichia coli strain DFL.5 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | N7217_RS03140 | Protein ID | WP_000347273.1 |
| Coordinates | 661444..661908 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | D6JF08 |
| Locus tag | N7217_RS03145 | Protein ID | WP_001308975.1 |
| Coordinates | 661908..662243 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7217_RS03110 (656445) | 656445..656879 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| N7217_RS03115 (656897) | 656897..657775 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N7217_RS03120 (657765) | 657765..658544 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N7217_RS03125 (658555) | 658555..659028 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N7217_RS03130 (659051) | 659051..660331 | - | 1281 | WP_023908831.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N7217_RS03135 (660580) | 660580..661389 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| N7217_RS03140 (661444) | 661444..661908 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N7217_RS03145 (661908) | 661908..662243 | - | 336 | WP_001308975.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N7217_RS03150 (662392) | 662392..663963 | - | 1572 | WP_023908830.1 | galactarate dehydratase | - |
| N7217_RS03155 (664338) | 664338..665672 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N7217_RS03160 (665688) | 665688..666458 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T259230 WP_000347273.1 NZ_CP104843:c661908-661444 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|