Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 32396..33053 | Replicon | plasmid unnamed6 |
| Accession | NZ_CP104842 | ||
| Organism | Enterobacter cloacae strain 2022CK-00409 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | N7S94_RS28015 | Protein ID | WP_000270043.1 |
| Coordinates | 32396..32746 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N7S94_RS28020 | Protein ID | WP_000124640.1 |
| Coordinates | 32751..33053 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7S94_RS27980 (N7S94_27970) | 28870..29367 | - | 498 | WP_000062185.1 | hypothetical protein | - |
| N7S94_RS27985 (N7S94_27975) | 29370..29858 | - | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| N7S94_RS27990 (N7S94_27980) | 29955..30290 | + | 336 | WP_000683476.1 | hypothetical protein | - |
| N7S94_RS27995 (N7S94_27985) | 30305..30775 | - | 471 | WP_001281821.1 | hypothetical protein | - |
| N7S94_RS28000 (N7S94_27990) | 30768..31139 | - | 372 | WP_000516916.1 | hypothetical protein | - |
| N7S94_RS28005 (N7S94_27995) | 31150..31344 | - | 195 | WP_000343597.1 | hypothetical protein | - |
| N7S94_RS28010 (N7S94_28000) | 31685..32233 | - | 549 | WP_001061574.1 | transcriptional regulator | - |
| N7S94_RS28015 (N7S94_28005) | 32396..32746 | + | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7S94_RS28020 (N7S94_28010) | 32751..33053 | + | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| N7S94_RS28025 (N7S94_28015) | 33080..33373 | - | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
| N7S94_RS28030 (N7S94_28020) | 33461..33733 | - | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
| N7S94_RS28035 (N7S94_28025) | 33791..34336 | - | 546 | WP_032413569.1 | thermonuclease family protein | - |
| N7S94_RS28040 (N7S94_28030) | 34460..35440 | - | 981 | WP_012569499.1 | IS5-like element ISKpn26 family transposase | - |
| N7S94_RS28045 (N7S94_28035) | 35749..36606 | - | 858 | WP_001167032.1 | hypothetical protein | - |
| N7S94_RS28050 (N7S94_28040) | 36593..36823 | - | 231 | WP_000972663.1 | hypothetical protein | - |
| N7S94_RS28055 (N7S94_28045) | 36823..37341 | - | 519 | WP_000210758.1 | nitrite reductase | - |
| N7S94_RS28060 (N7S94_28050) | 37338..37784 | - | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 / sul1 / qacE / aac(6')-33 / ant(2'')-Ia / blaTEM-1D / sul2 / floR | - | 1..209995 | 209995 | |
| - | flank | IS/Tn | - | - | 34460..35440 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T259228 WP_000270043.1 NZ_CP104842:32396-32746 [Enterobacter cloacae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|