Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 32396..33053 Replicon plasmid unnamed6
Accession NZ_CP104842
Organism Enterobacter cloacae strain 2022CK-00409

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag N7S94_RS28015 Protein ID WP_000270043.1
Coordinates 32396..32746 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag N7S94_RS28020 Protein ID WP_000124640.1
Coordinates 32751..33053 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7S94_RS27980 (N7S94_27970) 28870..29367 - 498 WP_000062185.1 hypothetical protein -
N7S94_RS27985 (N7S94_27975) 29370..29858 - 489 WP_001273096.1 DUF1643 domain-containing protein -
N7S94_RS27990 (N7S94_27980) 29955..30290 + 336 WP_000683476.1 hypothetical protein -
N7S94_RS27995 (N7S94_27985) 30305..30775 - 471 WP_001281821.1 hypothetical protein -
N7S94_RS28000 (N7S94_27990) 30768..31139 - 372 WP_000516916.1 hypothetical protein -
N7S94_RS28005 (N7S94_27995) 31150..31344 - 195 WP_000343597.1 hypothetical protein -
N7S94_RS28010 (N7S94_28000) 31685..32233 - 549 WP_001061574.1 transcriptional regulator -
N7S94_RS28015 (N7S94_28005) 32396..32746 + 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N7S94_RS28020 (N7S94_28010) 32751..33053 + 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
N7S94_RS28025 (N7S94_28015) 33080..33373 - 294 WP_001239997.1 chromosome segregation protein ParM -
N7S94_RS28030 (N7S94_28020) 33461..33733 - 273 WP_001043047.1 HU family DNA-binding protein -
N7S94_RS28035 (N7S94_28025) 33791..34336 - 546 WP_032413569.1 thermonuclease family protein -
N7S94_RS28040 (N7S94_28030) 34460..35440 - 981 WP_012569499.1 IS5-like element ISKpn26 family transposase -
N7S94_RS28045 (N7S94_28035) 35749..36606 - 858 WP_001167032.1 hypothetical protein -
N7S94_RS28050 (N7S94_28040) 36593..36823 - 231 WP_000972663.1 hypothetical protein -
N7S94_RS28055 (N7S94_28045) 36823..37341 - 519 WP_000210758.1 nitrite reductase -
N7S94_RS28060 (N7S94_28050) 37338..37784 - 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 / sul1 / qacE / aac(6')-33 / ant(2'')-Ia / blaTEM-1D / sul2 / floR - 1..209995 209995
- flank IS/Tn - - 34460..35440 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T259228 WP_000270043.1 NZ_CP104842:32396-32746 [Enterobacter cloacae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT259228 WP_000124640.1 NZ_CP104842:32751-33053 [Enterobacter cloacae]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References