Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 329718..330304 Replicon chromosome
Accession NZ_CP104796
Organism Klebsiella pneumoniae strain GX34

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag N7T97_RS01880 Protein ID WP_023285605.1
Coordinates 329936..330304 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag N7T97_RS01875 Protein ID WP_004174006.1
Coordinates 329718..329939 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7T97_RS01855 (325875) 325875..326801 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
N7T97_RS01860 (326798) 326798..328075 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
N7T97_RS01865 (328072) 328072..328839 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N7T97_RS01870 (328841) 328841..329554 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N7T97_RS01875 (329718) 329718..329939 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N7T97_RS01880 (329936) 329936..330304 + 369 WP_023285605.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N7T97_RS01885 (330577) 330577..331893 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N7T97_RS01890 (332000) 332000..332887 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N7T97_RS01895 (332884) 332884..333729 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N7T97_RS01900 (333731) 333731..334801 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 326798..335538 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13534.89 Da        Isoelectric Point: 8.6410

>T259189 WP_023285605.1 NZ_CP104796:329936-330304 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT259189 WP_004174006.1 NZ_CP104796:329718-329939 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References