Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 185523..185776 Replicon plasmid pHNSHP24-2
Accession NZ_CP104790
Organism Escherichia coli strain SHP24

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag N6H17_RS26155 Protein ID WP_001312851.1
Coordinates 185627..185776 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 185523..185581 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6H17_RS26125 (182053) 182053..182799 + 747 WP_000205734.1 conjugal transfer pilus acetylase TraX -
N6H17_RS26130 (182854) 182854..183414 + 561 WP_000139340.1 fertility inhibition protein FinO -
N6H17_RS26135 (183546) 183546..183758 + 213 WP_195686733.1 hypothetical protein -
N6H17_RS26140 (184004) 184004..184465 + 462 WP_195686734.1 thermonuclease family protein -
N6H17_RS26145 (184511) 184511..184720 + 210 WP_001488746.1 hemolysin expression modulator Hha -
N6H17_RS26150 (184758) 184758..185348 + 591 WP_000766805.1 DUF2726 domain-containing protein -
- (185523) 185523..185581 - 59 NuclAT_1 - Antitoxin
- (185523) 185523..185581 - 59 NuclAT_1 - Antitoxin
- (185523) 185523..185581 - 59 NuclAT_1 - Antitoxin
- (185523) 185523..185581 - 59 NuclAT_1 - Antitoxin
N6H17_RS26155 (185627) 185627..185776 + 150 WP_001312851.1 Hok/Gef family protein Toxin
N6H17_RS26160 (186060) 186060..186308 + 249 WP_000083832.1 replication regulatory protein RepA -
N6H17_RS26165 (186423) 186423..186609 + 187 Protein_198 protein CopA/IncA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - pic 1..186621 186621


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T259185 WP_001312851.1 NZ_CP104790:185627-185776 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 59 bp

>AT259185 NZ_CP104790:c185581-185523 [Escherichia coli]
AGGAACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References