Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 163455..163724 Replicon plasmid pHNSHP24-2
Accession NZ_CP104790
Organism Escherichia coli strain SHP24

Toxin (Protein)


Gene name hok Uniprot ID G9G195
Locus tag N6H17_RS26025 Protein ID WP_001323520.1
Coordinates 163608..163724 (+) Length 39 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 163455..163520 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6H17_RS25990 159220..159747 + 528 WP_261629680.1 single-stranded DNA-binding protein -
N6H17_RS25995 159805..160038 + 234 WP_000006010.1 DUF905 family protein -
N6H17_RS26000 160103..162067 + 1965 WP_261629681.1 ParB/RepB/Spo0J family partition protein -
N6H17_RS26005 162136..162570 + 435 WP_261629682.1 conjugation system SOS inhibitor PsiB -
N6H17_RS26010 162567..163329 + 763 Protein_167 plasmid SOS inhibition protein A -
- 163298..163522 + 225 NuclAT_0 - -
- 163298..163522 + 225 NuclAT_0 - -
- 163298..163522 + 225 NuclAT_0 - -
- 163298..163522 + 225 NuclAT_0 - -
N6H17_RS26015 163307..163486 - 180 WP_001309233.1 hypothetical protein -
- 163455..163520 - 66 - - Antitoxin
N6H17_RS26020 163508..163657 + 150 Protein_169 plasmid maintenance protein Mok -
N6H17_RS26025 163608..163724 + 117 WP_001323520.1 type I toxin-antitoxin system Hok family toxin Toxin
N6H17_RS26030 164043..164340 - 298 Protein_171 hypothetical protein -
N6H17_RS26035 164641..164928 + 288 WP_000107526.1 hypothetical protein -
N6H17_RS26040 165047..165868 + 822 WP_011666475.1 DUF932 domain-containing protein -
N6H17_RS26045 166164..166766 - 603 WP_077539848.1 transglycosylase SLT domain-containing protein -
N6H17_RS26050 167086..167469 + 384 WP_001151524.1 conjugal transfer relaxosome DNA-binding protein TraM -
N6H17_RS26055 167656..168345 + 690 WP_261629683.1 conjugal transfer transcriptional regulator TraJ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - pic 1..186621 186621


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(1-34)


Sequences

Toxin        


Download         Length: 39 a.a.        Molecular weight: 4455.23 Da        Isoelectric Point: 8.5110

>T259182 WP_001323520.1 NZ_CP104790:163608-163724 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Download         Length: 117 bp

Antitoxin


Download         Length: 66 bp

>AT259182 NZ_CP104790:c163520-163455 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G9G195

Antitoxin

Download structure file

References