Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 311582..312276 | Replicon | chromosome |
| Accession | NZ_CP104788 | ||
| Organism | Escherichia coli strain SHP24 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | N6H17_RS01455 | Protein ID | WP_001263489.1 |
| Coordinates | 311878..312276 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | N6H17_RS01450 | Protein ID | WP_000554758.1 |
| Coordinates | 311582..311875 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6H17_RS01430 (307214) | 307214..307711 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
| N6H17_RS01435 (307935) | 307935..309647 | - | 1713 | Protein_279 | flagellar biosynthesis protein FlhA | - |
| N6H17_RS01440 (309619) | 309619..310404 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| N6H17_RS01445 (310475) | 310475..311530 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| N6H17_RS01450 (311582) | 311582..311875 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N6H17_RS01455 (311878) | 311878..312276 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| N6H17_RS01460 (312286) | 312286..312738 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| N6H17_RS01465 (313056) | 313056..313262 | + | 207 | Protein_285 | RtcB family protein | - |
| N6H17_RS01470 (313258) | 313258..313779 | + | 522 | Protein_286 | peptide chain release factor H | - |
| N6H17_RS01475 (313836) | 313836..315293 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| N6H17_RS01480 (315554) | 315554..316012 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (316608) | 316608..316688 | + | 81 | NuclAT_11 | - | - |
| - (316608) | 316608..316688 | + | 81 | NuclAT_11 | - | - |
| - (316608) | 316608..316688 | + | 81 | NuclAT_11 | - | - |
| - (316608) | 316608..316688 | + | 81 | NuclAT_11 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T259158 WP_001263489.1 NZ_CP104788:311878-312276 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |