Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) DinJ-YafQ (relBE)/YafQ-DinJ
Location 1108544..1109069 Replicon chromosome
Accession NZ_CP104762
Organism Enterococcus raffinosus strain ATCC 49464

Toxin (Protein)


Gene name yafQ Uniprot ID R2RHN7
Locus tag N7K38_RS05655 Protein ID WP_010746334.1
Coordinates 1108791..1109069 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R2QVJ0
Locus tag N7K38_RS05650 Protein ID WP_010746335.1
Coordinates 1108544..1108804 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7K38_RS05630 (1103581) 1103581..1103853 - 273 WP_010746338.1 transposase -
N7K38_RS05635 (1105765) 1105765..1107012 + 1248 WP_010743568.1 IS256 family transposase -
N7K38_RS05640 (1107250) 1107250..1107630 - 381 WP_010746337.1 recombinase family protein -
N7K38_RS05645 (1107670) 1107670..1107807 - 138 WP_010746336.1 recombinase family protein -
N7K38_RS05650 (1108544) 1108544..1108804 + 261 WP_010746335.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
N7K38_RS05655 (1108791) 1108791..1109069 + 279 WP_010746334.1 type II toxin-antitoxin system YafQ family toxin Toxin
N7K38_RS05660 (1109351) 1109351..1109485 + 135 WP_010746332.1 hypothetical protein -
N7K38_RS05665 (1109593) 1109593..1110840 - 1248 WP_010743568.1 IS256 family transposase -
N7K38_RS05670 (1111087) 1111087..1111434 - 348 WP_010746331.1 hypothetical protein -
N7K38_RS05675 (1111616) 1111616..1111728 + 113 Protein_1117 replication initiator protein A -
N7K38_RS05680 (1111965) 1111965..1112285 + 321 WP_010746330.1 DUF5839 family protein -
N7K38_RS05685 (1112625) 1112625..1112819 + 195 WP_010746329.1 hypothetical protein -
N7K38_RS05690 (1112841) 1112841..1113437 + 597 Protein_1120 UPF0236 family protein -
N7K38_RS05695 (1113475) 1113475..1113921 + 447 WP_010746327.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - ebpC 1028724..1118411 89687
- inside IScluster/Tn - - 1105765..1110840 5075


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-83)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 11227.16 Da        Isoelectric Point: 10.0558

>T259133 WP_010746334.1 NZ_CP104762:1108791-1109069 [Enterococcus raffinosus]
MLTIEYTSIFKRDYKRMVKKHYNMKKLEKVVKLLVTNNQDELIRKYKDHALKGNWKGYRELHLDNDWLLIYKIDDKNLIL
TMTRTGSHDELL

Download         Length: 279 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9858.16 Da        Isoelectric Point: 4.3775

>AT259133 WP_010746335.1 NZ_CP104762:1108544-1108804 [Enterococcus raffinosus]
MTVSRLNIRIDGDLKQQAKEVYKDMGMDLTTAVTIFLKQSVREQRLPFQPSREPIENVIARYEVENGLTTKVDSAEELME
NLNADD

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R2RHN7

Antitoxin

Source ID Structure
AlphaFold DB R2QVJ0

References