Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4433013..4433677 | Replicon | chromosome |
Accession | NZ_CP104755 | ||
Organism | Shewanella putrefaciens strain 4H |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N5094_RS19570 | Protein ID | WP_259650362.1 |
Coordinates | 4433013..4433255 (+) | Length | 81 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5094_RS19575 | Protein ID | WP_014611555.1 |
Coordinates | 4433261..4433677 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5094_RS19550 (N5094_19550) | 4428346..4431351 | - | 3006 | WP_220778023.1 | Tn3 family transposase | - |
N5094_RS19555 (N5094_19555) | 4431514..4432077 | + | 564 | WP_220778011.1 | recombinase family protein | - |
N5094_RS19560 (N5094_19560) | 4432233..4432496 | + | 264 | Protein_3781 | hypothetical protein | - |
N5094_RS19565 (N5094_19565) | 4432552..4432647 | - | 96 | Protein_3782 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
N5094_RS19570 (N5094_19570) | 4433013..4433255 | + | 243 | WP_259650362.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
N5094_RS19575 (N5094_19575) | 4433261..4433677 | + | 417 | WP_014611555.1 | transcriptional regulator | Antitoxin |
N5094_RS19580 (N5094_19580) | 4433886..4435094 | - | 1209 | WP_001206290.1 | IS4-like element IS10A family transposase | - |
N5094_RS19585 (N5094_19585) | 4435408..4435662 | + | 255 | WP_259524104.1 | hypothetical protein | - |
N5094_RS19590 (N5094_19590) | 4435727..4436866 | + | 1140 | WP_019677804.1 | AraC family transcriptional regulator | - |
N5094_RS19595 (N5094_19595) | 4437083..4437673 | + | 591 | WP_261762202.1 | DUF6448 family protein | - |
N5094_RS19600 (N5094_19600) | 4437782..4438057 | - | 276 | WP_227510224.1 | MipA/OmpV family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 4428346..4435094 | 6748 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 81 a.a. Molecular weight: 9645.93 Da Isoelectric Point: 9.9876
>T259111 WP_259650362.1 NZ_CP104755:4433013-4433255 [Shewanella putrefaciens]
VQIYSTLRSGTFTNPDDLRQVFPSLDNFKYRDKWWVIDVGGNNLRIIAFIEFRDNRMYVKHVVSHADYSKLTDKYRRTKE
VQIYSTLRSGTFTNPDDLRQVFPSLDNFKYRDKWWVIDVGGNNLRIIAFIEFRDNRMYVKHVVSHADYSKLTDKYRRTKE
Download Length: 243 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15520.72 Da Isoelectric Point: 4.2543
>AT259111 WP_014611555.1 NZ_CP104755:4433261-4433677 [Shewanella putrefaciens]
MLPTACIEIREALAKVPYLAHIETQDDYEQALVLMDDLVDDYDSNKFLIEMLSLSIERWEEQADEFAEFNAAIAEMDSGI
AVLKTLMSQYRLGVADLPELGSKSNVSKLLNAAEGKKLNRHHIEALSQRFGVPVSLFF
MLPTACIEIREALAKVPYLAHIETQDDYEQALVLMDDLVDDYDSNKFLIEMLSLSIERWEEQADEFAEFNAAIAEMDSGI
AVLKTLMSQYRLGVADLPELGSKSNVSKLLNAAEGKKLNRHHIEALSQRFGVPVSLFF
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|