Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 1594171..1594781 | Replicon | chromosome |
Accession | NZ_CP104745 | ||
Organism | Erwinia pyrifoliae strain CP20113301 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NYP80_RS07810 | Protein ID | WP_259818088.1 |
Coordinates | 1594470..1594781 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYP80_RS07805 | Protein ID | WP_259818087.1 |
Coordinates | 1594171..1594467 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP80_RS07775 (NYP80_07775) | 1590314..1590469 | - | 156 | WP_168400670.1 | GpE family phage tail protein | - |
NYP80_RS07780 (NYP80_07780) | 1590475..1590792 | - | 318 | WP_259825661.1 | phage tail assembly protein | - |
NYP80_RS07785 (NYP80_07785) | 1590840..1591355 | - | 516 | WP_259818084.1 | phage major tail tube protein | - |
NYP80_RS07790 (NYP80_07790) | 1591356..1592537 | - | 1182 | WP_259818085.1 | phage tail sheath family protein | - |
NYP80_RS07795 (NYP80_07795) | 1592689..1593825 | + | 1137 | WP_259819525.1 | phage late control D family protein | - |
NYP80_RS07800 (NYP80_07800) | 1593865..1594113 | + | 249 | WP_012668492.1 | ogr/Delta-like zinc finger family protein | - |
NYP80_RS07805 (NYP80_07805) | 1594171..1594467 | - | 297 | WP_259818087.1 | NadS family protein | Antitoxin |
NYP80_RS07810 (NYP80_07810) | 1594470..1594781 | - | 312 | WP_259818088.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYP80_RS07815 (NYP80_07815) | 1595194..1595442 | - | 249 | WP_012668492.1 | ogr/Delta-like zinc finger family protein | - |
NYP80_RS07820 (NYP80_07820) | 1595482..1595798 | - | 317 | Protein_1471 | contractile injection system protein, VgrG/Pvc8 family | - |
NYP80_RS07825 (NYP80_07825) | 1596097..1597005 | + | 909 | WP_012668491.1 | hypothetical protein | - |
NYP80_RS07830 (NYP80_07830) | 1597109..1597361 | + | 253 | Protein_1473 | IS110 family transposase | - |
NYP80_RS07835 (NYP80_07835) | 1598076..1599218 | + | 1143 | WP_261648098.1 | hypothetical protein | - |
NYP80_RS07840 (NYP80_07840) | 1599322..1599574 | + | 253 | Protein_1475 | IS110 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1560976..1601428 | 40452 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12033.69 Da Isoelectric Point: 7.0154
>T259098 WP_259818088.1 NZ_CP104745:c1594781-1594470 [Erwinia pyrifoliae]
MLFIETAIFTEDVKELLTDDEYREFQQFLADNPGWGDVIQQTGGLRKVRWSAKGKGKRGGVRVIYFHKVSESQIRLLLIY
KKGIQDDLSDDEKRQLRTLNEGW
MLFIETAIFTEDVKELLTDDEYREFQQFLADNPGWGDVIQQTGGLRKVRWSAKGKGKRGGVRVIYFHKVSESQIRLLLIY
KKGIQDDLSDDEKRQLRTLNEGW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|