Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 1594171..1594781 Replicon chromosome
Accession NZ_CP104745
Organism Erwinia pyrifoliae strain CP20113301

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag NYP80_RS07810 Protein ID WP_259818088.1
Coordinates 1594470..1594781 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NYP80_RS07805 Protein ID WP_259818087.1
Coordinates 1594171..1594467 (-) Length 99 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYP80_RS07775 (NYP80_07775) 1590314..1590469 - 156 WP_168400670.1 GpE family phage tail protein -
NYP80_RS07780 (NYP80_07780) 1590475..1590792 - 318 WP_259825661.1 phage tail assembly protein -
NYP80_RS07785 (NYP80_07785) 1590840..1591355 - 516 WP_259818084.1 phage major tail tube protein -
NYP80_RS07790 (NYP80_07790) 1591356..1592537 - 1182 WP_259818085.1 phage tail sheath family protein -
NYP80_RS07795 (NYP80_07795) 1592689..1593825 + 1137 WP_259819525.1 phage late control D family protein -
NYP80_RS07800 (NYP80_07800) 1593865..1594113 + 249 WP_012668492.1 ogr/Delta-like zinc finger family protein -
NYP80_RS07805 (NYP80_07805) 1594171..1594467 - 297 WP_259818087.1 NadS family protein Antitoxin
NYP80_RS07810 (NYP80_07810) 1594470..1594781 - 312 WP_259818088.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NYP80_RS07815 (NYP80_07815) 1595194..1595442 - 249 WP_012668492.1 ogr/Delta-like zinc finger family protein -
NYP80_RS07820 (NYP80_07820) 1595482..1595798 - 317 Protein_1471 contractile injection system protein, VgrG/Pvc8 family -
NYP80_RS07825 (NYP80_07825) 1596097..1597005 + 909 WP_012668491.1 hypothetical protein -
NYP80_RS07830 (NYP80_07830) 1597109..1597361 + 253 Protein_1473 IS110 family transposase -
NYP80_RS07835 (NYP80_07835) 1598076..1599218 + 1143 WP_261648098.1 hypothetical protein -
NYP80_RS07840 (NYP80_07840) 1599322..1599574 + 253 Protein_1475 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1560976..1601428 40452


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(43-100)

Antitoxin

Cro/C1-type helix-turn-helix domain

(36-87)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12033.69 Da        Isoelectric Point: 7.0154

>T259098 WP_259818088.1 NZ_CP104745:c1594781-1594470 [Erwinia pyrifoliae]
MLFIETAIFTEDVKELLTDDEYREFQQFLADNPGWGDVIQQTGGLRKVRWSAKGKGKRGGVRVIYFHKVSESQIRLLLIY
KKGIQDDLSDDEKRQLRTLNEGW

Download         Length: 312 bp

Antitoxin


Download         Length: 99 a.a.        Molecular weight: 10915.51 Da        Isoelectric Point: 10.5573

>AT259098 WP_259818087.1 NZ_CP104745:c1594467-1594171 [Erwinia pyrifoliae]
MEKKLFERLKESMTQMNEINEGSRDPSRETNVIAVQVKAIRTASGLSQSGFAKLISVNLDTLKNWEQGRREPTGPAKALL
RAIERDPQHVIPALSAKS

Download         Length: 297 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References