Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 1623318..1623940 | Replicon | chromosome |
Accession | NZ_CP104727 | ||
Organism | Pseudomonas citronellolis strain G5.80 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N5P21_RS07170 | Protein ID | WP_261747808.1 |
Coordinates | 1623626..1623940 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5P21_RS07165 | Protein ID | WP_261747807.1 |
Coordinates | 1623318..1623623 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5P21_RS07145 (N5P21_07145) | 1618943..1619455 | - | 513 | WP_074979044.1 | RDD family protein | - |
N5P21_RS07150 (N5P21_07150) | 1619624..1621165 | + | 1542 | WP_261747804.1 | cyclic diguanylate phosphodiesterase | - |
N5P21_RS07155 (N5P21_07155) | 1621259..1621597 | - | 339 | WP_261747805.1 | hypothetical protein | - |
N5P21_RS07160 (N5P21_07160) | 1621688..1623133 | - | 1446 | WP_261747806.1 | SulP family inorganic anion transporter | - |
N5P21_RS07165 (N5P21_07165) | 1623318..1623623 | - | 306 | WP_261747807.1 | helix-turn-helix domain-containing protein | Antitoxin |
N5P21_RS07170 (N5P21_07170) | 1623626..1623940 | - | 315 | WP_261747808.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5P21_RS07175 (N5P21_07175) | 1624235..1625137 | + | 903 | WP_261747809.1 | site-specific integrase | - |
N5P21_RS07180 (N5P21_07180) | 1625164..1625982 | - | 819 | WP_116423177.1 | hypothetical protein | - |
N5P21_RS07185 (N5P21_07185) | 1625957..1626118 | - | 162 | WP_181925962.1 | hypothetical protein | - |
N5P21_RS07190 (N5P21_07190) | 1626833..1627072 | - | 240 | WP_261748818.1 | hypothetical protein | - |
N5P21_RS07195 (N5P21_07195) | 1627112..1627636 | + | 525 | Protein_1420 | hypothetical protein | - |
N5P21_RS07200 (N5P21_07200) | 1627786..1628439 | + | 654 | WP_261747810.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11808.53 Da Isoelectric Point: 9.4819
>T259069 WP_261747808.1 NZ_CP104727:c1623940-1623626 [Pseudomonas citronellolis]
MIFIETPVFTRQILELVDDETYRRLQEDLTLHPDAGTVIAGTGGVRKIRIAANGHGKRGGARVIYYHFVSASHIAFLLAY
DKATQEDLTANQKKVLRQIIENWR
MIFIETPVFTRQILELVDDETYRRLQEDLTLHPDAGTVIAGTGGVRKIRIAANGHGKRGGARVIYYHFVSASHIAFLLAY
DKATQEDLTANQKKVLRQIIENWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|