Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1153174..1153823 | Replicon | chromosome |
Accession | NZ_CP104724 | ||
Organism | Enterobacter kobei strain SG.H2a |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N5P26_RS05405 | Protein ID | WP_196347061.1 |
Coordinates | 1153461..1153823 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A2W0GCS7 |
Locus tag | N5P26_RS05400 | Protein ID | WP_014882863.1 |
Coordinates | 1153174..1153473 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5P26_RS05390 (N5P26_05390) | 1149599..1151572 | + | 1974 | WP_063434035.1 | PhoX family phosphatase | - |
N5P26_RS05395 (N5P26_05395) | 1151675..1153063 | + | 1389 | WP_196347059.1 | phenylalanine transporter | - |
N5P26_RS05400 (N5P26_05400) | 1153174..1153473 | - | 300 | WP_014882863.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N5P26_RS05405 (N5P26_05405) | 1153461..1153823 | - | 363 | WP_196347061.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5P26_RS05410 (N5P26_05410) | 1154029..1155264 | + | 1236 | WP_023332295.1 | MFS transporter | - |
N5P26_RS05415 (N5P26_05415) | 1155280..1156305 | + | 1026 | WP_063666829.1 | sugar phosphate isomerase/epimerase family protein | - |
N5P26_RS05420 (N5P26_05420) | 1156298..1157440 | + | 1143 | WP_196347063.1 | Gfo/Idh/MocA family oxidoreductase | - |
N5P26_RS05425 (N5P26_05425) | 1157516..1158487 | + | 972 | WP_196347065.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 14053.04 Da Isoelectric Point: 6.7121
>T259058 WP_196347061.1 NZ_CP104724:c1153823-1153461 [Enterobacter kobei]
MWNVETTDRFDQWYFEQTTALKEDVLAMMHILAEFGPTLGRPYVDTVKASAYANMKELRIQHAGNPIRAFFAFDPDRKAI
VLCARDKTGCNQKRFYNEMITLADVEYSRHLADKEAIWQR
MWNVETTDRFDQWYFEQTTALKEDVLAMMHILAEFGPTLGRPYVDTVKASAYANMKELRIQHAGNPIRAFFAFDPDRKAI
VLCARDKTGCNQKRFYNEMITLADVEYSRHLADKEAIWQR
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|