Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 947956..948650 | Replicon | chromosome |
| Accession | NZ_CP104724 | ||
| Organism | Enterobacter kobei strain SG.H2a | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | - |
| Locus tag | N5P26_RS04445 | Protein ID | WP_263441988.1 |
| Coordinates | 948246..948650 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | A0A285AZA0 |
| Locus tag | N5P26_RS04440 | Protein ID | WP_073395581.1 |
| Coordinates | 947956..948249 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5P26_RS04420 (N5P26_04420) | 943872..944081 | - | 210 | WP_133116564.1 | hypothetical protein | - |
| N5P26_RS04425 (N5P26_04425) | 944122..945375 | - | 1254 | WP_201505864.1 | DUF3644 domain-containing protein | - |
| N5P26_RS04430 (N5P26_04430) | 945452..946432 | - | 981 | WP_261660238.1 | hypothetical protein | - |
| N5P26_RS04435 (N5P26_04435) | 946516..947415 | - | 900 | WP_163330390.1 | DUF4365 domain-containing protein | - |
| N5P26_RS04440 (N5P26_04440) | 947956..948249 | + | 294 | WP_073395581.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N5P26_RS04445 (N5P26_04445) | 948246..948650 | + | 405 | WP_263441988.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
| N5P26_RS04450 (N5P26_04450) | 949485..949865 | - | 381 | WP_045281706.1 | hypothetical protein | - |
| N5P26_RS04455 (N5P26_04455) | 950301..950768 | - | 468 | WP_045281705.1 | GNAT family N-acetyltransferase | - |
| N5P26_RS04460 (N5P26_04460) | 951065..951835 | - | 771 | WP_213784176.1 | class I SAM-dependent methyltransferase | - |
| N5P26_RS04465 (N5P26_04465) | 951846..952103 | - | 258 | WP_014882706.1 | YjhX family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 927303..950768 | 23465 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15512.89 Da Isoelectric Point: 7.1284
>T259056 WP_263441988.1 NZ_CP104724:948246-948650 [Enterobacter kobei]
MSIRIFKSALIRQQLIQQELDDLAADFLSYKKDGVLPDTFGRDAPYDDDRTYPLVKEEQVAHIHLADADAPFPKFLRQFK
RTSDQAHLVYCQGAMDPDAYLLIIILKPEAHKMARNNNHMHKIGMMAEAFRMKH
MSIRIFKSALIRQQLIQQELDDLAADFLSYKKDGVLPDTFGRDAPYDDDRTYPLVKEEQVAHIHLADADAPFPKFLRQFK
RTSDQAHLVYCQGAMDPDAYLLIIILKPEAHKMARNNNHMHKIGMMAEAFRMKH
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|