Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 31715..32445 | Replicon | chromosome |
| Accession | NZ_CP104724 | ||
| Organism | Enterobacter kobei strain SG.H2a | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2W0GI63 |
| Locus tag | N5P26_RS00150 | Protein ID | WP_023331686.1 |
| Coordinates | 31715..32029 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5P26_RS00155 | Protein ID | WP_023331687.1 |
| Coordinates | 32026..32445 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5P26_RS00130 (N5P26_00130) | 27380..28468 | + | 1089 | WP_032635252.1 | cellulase family glycosylhydrolase | - |
| N5P26_RS00135 (N5P26_00135) | 28371..29555 | - | 1185 | WP_193970929.1 | multidrug efflux MFS transporter EmrD | - |
| N5P26_RS00140 (N5P26_00140) | 29731..30564 | - | 834 | WP_196347604.1 | EamA family transporter | - |
| N5P26_RS00145 (N5P26_00145) | 30627..31073 | - | 447 | WP_014881927.1 | GNAT family N-acetyltransferase | - |
| N5P26_RS00150 (N5P26_00150) | 31715..32029 | + | 315 | WP_023331686.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N5P26_RS00155 (N5P26_00155) | 32026..32445 | + | 420 | WP_023331687.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N5P26_RS00160 (N5P26_00160) | 32595..32693 | + | 99 | WP_023331688.1 | ilvB operon leader peptide IvbL | - |
| N5P26_RS00165 (N5P26_00165) | 32800..34488 | + | 1689 | WP_023331689.1 | acetolactate synthase large subunit | - |
| N5P26_RS00170 (N5P26_00170) | 34492..34779 | + | 288 | WP_010426528.1 | acetolactate synthase small subunit | - |
| N5P26_RS00175 (N5P26_00175) | 34862..35455 | + | 594 | WP_014881931.1 | transcriptional regulator UhpA | - |
| N5P26_RS00180 (N5P26_00180) | 35452..36957 | + | 1506 | WP_045134486.1 | signal transduction histidine-protein kinase/phosphatase UhpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12441.59 Da Isoelectric Point: 10.2825
>T259055 WP_023331686.1 NZ_CP104724:31715-32029 [Enterobacter kobei]
MHLISMKAILDAVIQFPQHREELLFLGRTIEKSHCTTPVALRKIFPTLDNLKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
MHLISMKAILDAVIQFPQHREELLFLGRTIEKSHCTTPVALRKIFPTLDNLKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15561.18 Da Isoelectric Point: 5.6761
>AT259055 WP_023331687.1 NZ_CP104724:32026-32445 [Enterobacter kobei]
MMIVADAMKATHALVAAVPLLGEHPNEKDYQDALELVEYLLMNEPGSPLLDIVCARIRRYEANRPEIVALRQEMESVPVG
IAVLRTLMDQYKLTISDFQDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
MMIVADAMKATHALVAAVPLLGEHPNEKDYQDALELVEYLLMNEPGSPLLDIVCARIRRYEANRPEIVALRQEMESVPVG
IAVLRTLMDQYKLTISDFQDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|