Detailed information of TA system TA259054

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/COG4683-HTH_37
• Location: 19295..19952
• Replicon: plasmid pECO3183-1
• Accession: NZ_CP104722
• Organism: Escherichia coli strain ECO3183

Toxin (Protein)

• Gene name: higB
• Uniprot ID: U3PDC3
• Locus tag: N5O92_RS23520
• Protein ID: WP_000270043.1
• Coordinates: 19295..19645 (+)
• Length: 117 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: N5O92_RS23525
• Protein ID: WP_000124640.1
• Coordinates: 19650..19952 (+)
• Length: 101 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N5O92_RS23480 (N5O92_23480)	14850..15554	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
N5O92_RS23485 (N5O92_23485)	15769..16266	-	498	WP_000062185.1	hypothetical protein	-
N5O92_RS23490 (N5O92_23490)	16269..16757	-	489	WP_001273096.1	DUF1643 domain-containing protein	-
N5O92_RS23495 (N5O92_23495)	16854..17189	+	336	WP_000683476.1	hypothetical protein	-
N5O92_RS23500 (N5O92_23500)	17204..17674	-	471	WP_001281821.1	hypothetical protein	-
N5O92_RS23505 (N5O92_23505)	17667..18038	-	372	WP_000516916.1	hypothetical protein	-
N5O92_RS23510 (N5O92_23510)	18049..18243	-	195	WP_000343597.1	hypothetical protein	-
N5O92_RS23515 (N5O92_23515)	18584..19132	-	549	WP_001061574.1	transcriptional regulator	-
N5O92_RS23520 (N5O92_23520)	19295..19645	+	351	WP_000270043.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
N5O92_RS23525 (N5O92_23525)	19650..19952	+	303	WP_000124640.1	XRE family transcriptional regulator	Antitoxin
N5O92_RS23530 (N5O92_23530)	19979..20272	-	294	WP_001239997.1	chromosome segregation protein ParM	-
N5O92_RS23535 (N5O92_23535)	20360..20632	-	273	WP_001043047.1	HU family DNA-binding protein	-
N5O92_RS23540 (N5O92_23540)	20690..21217	-	528	WP_001236377.1	thermonuclease family protein	-
N5O92_RS23545 (N5O92_23545)	21234..21422	-	189	WP_001270411.1	hypothetical protein	-
N5O92_RS23550 (N5O92_23550)	21448..22305	-	858	WP_001167032.1	hypothetical protein	-
N5O92_RS23555 (N5O92_23555)	22292..22522	-	231	WP_000972663.1	hypothetical protein	-
N5O92_RS23560 (N5O92_23560)	22522..23040	-	519	WP_000210756.1	nitrite reductase	-
N5O92_RS23565 (N5O92_23565)	23037..23483	-	447	WP_000919345.1	Fe3+-siderophore ABC transporter permease	-
N5O92_RS23570 (N5O92_23570)	23483..23842	-	360	WP_000422768.1	hypothetical protein	-
N5O92_RS23575 (N5O92_23575)	23899..24327	-	429	WP_000591074.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	mph(A) / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / aac(3)-IId / sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / tet(A) / floR	-	1..167630	167630

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-like (12-106)

Antitoxin

• Cro/C1-type helix-turn-helix domain (33-79)

Sequences

Toxin

Protein

• Length: 117 a.a.
• Molecular weight: 13328.21 Da
• Isoelectric Point: 5.2421

>T259054 WP_000270043.1 NZ_CP104722:19295-19645 [Escherichia coli]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Nucleotide

• Length: 351 bp

Antitoxin

Protein

• Length: 101 a.a.
• Molecular weight: 11006.73 Da
• Isoelectric Point: 7.2036

>AT259054 WP_000124640.1 NZ_CP104722:19650-19952 [Escherichia coli]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Nucleotide

• Length: 303 bp

Structures

Toxin

• AlphaFold DB: A0A7G8AFB9