Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5048608..5049203 | Replicon | chromosome |
| Accession | NZ_CP104720 | ||
| Organism | Pseudomonas aeruginosa strain NY4593 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | N5P33_RS23515 | Protein ID | WP_003113526.1 |
| Coordinates | 5048925..5049203 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5P33_RS23510 | Protein ID | WP_003113527.1 |
| Coordinates | 5048608..5048913 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5P33_RS23475 (N5P33_23475) | 5043748..5044596 | + | 849 | WP_003146058.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| N5P33_RS23485 (N5P33_23485) | 5044763..5045704 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| N5P33_RS23490 (N5P33_23490) | 5045821..5046435 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| N5P33_RS23495 (N5P33_23495) | 5046477..5047061 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| N5P33_RS23500 (N5P33_23500) | 5047102..5048202 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| N5P33_RS23510 (N5P33_23510) | 5048608..5048913 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| N5P33_RS23515 (N5P33_23515) | 5048925..5049203 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5P33_RS23520 (N5P33_23520) | 5049256..5049384 | - | 129 | Protein_4642 | integrase | - |
| N5P33_RS23525 (N5P33_23525) | 5049532..5051760 | + | 2229 | WP_034071371.1 | TonB-dependent receptor | - |
| N5P33_RS23530 (N5P33_23530) | 5051830..5052477 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| N5P33_RS23535 (N5P33_23535) | 5052539..5053777 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T259034 WP_003113526.1 NZ_CP104720:c5049203-5048925 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|