Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4437264..4437945 | Replicon | chromosome |
Accession | NZ_CP104720 | ||
Organism | Pseudomonas aeruginosa strain NY4593 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N5P33_RS20720 | Protein ID | WP_015503432.1 |
Coordinates | 4437580..4437945 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A643IYQ7 |
Locus tag | N5P33_RS20715 | Protein ID | WP_034071998.1 |
Coordinates | 4437264..4437587 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5P33_RS20690 (N5P33_20690) | 4433178..4433816 | + | 639 | WP_034072001.1 | hypothetical protein | - |
N5P33_RS20695 (N5P33_20695) | 4434059..4434394 | + | 336 | WP_003140884.1 | TM2 domain-containing protein | - |
N5P33_RS20700 (N5P33_20700) | 4434568..4435086 | + | 519 | WP_022579807.1 | PAAR domain-containing protein | - |
N5P33_RS20705 (N5P33_20705) | 4435083..4435784 | + | 702 | WP_003111822.1 | VRR-NUC domain-containing protein | - |
N5P33_RS20710 (N5P33_20710) | 4435801..4436889 | + | 1089 | WP_034071999.1 | DUF3396 domain-containing protein | - |
N5P33_RS20715 (N5P33_20715) | 4437264..4437587 | - | 324 | WP_034071998.1 | XRE family transcriptional regulator | Antitoxin |
N5P33_RS20720 (N5P33_20720) | 4437580..4437945 | - | 366 | WP_015503432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5P33_RS20725 (N5P33_20725) | 4438209..4438448 | - | 240 | WP_044069615.1 | hypothetical protein | - |
N5P33_RS20730 (N5P33_20730) | 4438655..4438927 | + | 273 | WP_003124230.1 | hypothetical protein | - |
N5P33_RS20735 (N5P33_20735) | 4438958..4439383 | - | 426 | WP_003116492.1 | VOC family protein | - |
N5P33_RS20740 (N5P33_20740) | 4439484..4440368 | + | 885 | WP_034071997.1 | LysR substrate-binding domain-containing protein | - |
N5P33_RS20745 (N5P33_20745) | 4440341..4441294 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
N5P33_RS20750 (N5P33_20750) | 4441515..4441949 | + | 435 | WP_134253793.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13798.14 Da Isoelectric Point: 4.8219
>T259033 WP_015503432.1 NZ_CP104720:c4437945-4437580 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|