Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 23395..24122 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP104683 | ||
| Organism | Escherichia coli strain 2022CK-00450 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A663AUB1 |
| Locus tag | N5922_RS25250 | Protein ID | WP_000558568.1 |
| Coordinates | 23395..23706 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | V0AHC4 |
| Locus tag | N5922_RS25255 | Protein ID | WP_000990392.1 |
| Coordinates | 23703..24122 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5922_RS25220 (N5922_25215) | 18717..19414 | + | 698 | WP_223335778.1 | IS1 family transposase | - |
| N5922_RS25225 (N5922_25220) | 19424..20506 | + | 1083 | WP_032140505.1 | lytic murein transglycosylase B | - |
| N5922_RS25230 (N5922_25225) | 20614..21471 | - | 858 | Protein_21 | APC family permease | - |
| N5922_RS25235 (N5922_25230) | 21524..22228 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| N5922_RS25240 (N5922_25235) | 22293..22754 | + | 462 | Protein_23 | lactate utilization protein C | - |
| N5922_RS25245 (N5922_25240) | 22804..23184 | - | 381 | Protein_24 | gluconate permease | - |
| N5922_RS25250 (N5922_25245) | 23395..23706 | + | 312 | WP_000558568.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N5922_RS25255 (N5922_25250) | 23703..24122 | + | 420 | WP_000990392.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N5922_RS25265 (N5922_25260) | 25566..25766 | - | 201 | Protein_28 | hypothetical protein | - |
| N5922_RS25270 (N5922_25265) | 25928..26278 | + | 351 | WP_000928911.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| N5922_RS25275 (N5922_25270) | 26583..27059 | - | 477 | WP_000043177.1 | Dps family protein | - |
| N5922_RS25280 (N5922_25275) | 27183..28130 | - | 948 | Protein_31 | transposase | - |
| N5922_RS25285 (N5922_25280) | 28196..28900 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..122304 | 122304 | |
| - | inside | IScluster/Tn | - | - | 18717..42312 | 23595 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12372.11 Da Isoelectric Point: 10.0935
>T259000 WP_000558568.1 NZ_CP104683:23395-23706 [Escherichia coli]
MHVVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
MHVVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15534.71 Da Isoelectric Point: 4.4702
>AT259000 WP_000990392.1 NZ_CP104683:23703-24122 [Escherichia coli]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A663AUB1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AHC4 |