258999

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 196207..196864 Replicon plasmid unnamed1
Accession NZ_CP104682
Organism Escherichia coli strain 2022CK-00450

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag N5922_RS25005 Protein ID WP_000270043.1
Coordinates 196514..196864 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag N5922_RS25000 Protein ID WP_000124640.1
Coordinates 196207..196509 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5922_RS24955 (N5922_24950) 191476..191922 + 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
N5922_RS24960 (N5922_24955) 191919..192437 + 519 WP_000210758.1 nitrite reductase -
N5922_RS24965 (N5922_24960) 192437..192667 + 231 WP_000972663.1 hypothetical protein -
N5922_RS24970 (N5922_24965) 192654..193511 + 858 WP_001167032.1 hypothetical protein -
N5922_RS24975 (N5922_24970) 193537..193725 + 189 WP_001270411.1 hypothetical protein -
N5922_RS24980 (N5922_24975) 193820..194800 + 981 WP_012569499.1 IS5-like element ISKpn26 family transposase -
N5922_RS24985 (N5922_24980) 194924..195469 + 546 WP_032413569.1 thermonuclease family protein -
N5922_RS24990 (N5922_24985) 195527..195799 + 273 WP_001043047.1 HU family DNA-binding protein -
N5922_RS24995 (N5922_24990) 195887..196180 + 294 WP_001239997.1 chromosome segregation protein ParM -
N5922_RS25000 (N5922_24995) 196207..196509 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
N5922_RS25005 (N5922_25000) 196514..196864 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5922_RS25010 (N5922_25005) 197027..197575 + 549 WP_001061574.1 transcriptional regulator -
N5922_RS25015 (N5922_25010) 197916..198110 + 195 WP_000343597.1 hypothetical protein -
N5922_RS25020 (N5922_25015) 198121..198492 + 372 WP_000516916.1 hypothetical protein -
N5922_RS25025 (N5922_25020) 198485..198955 + 471 WP_001281821.1 hypothetical protein -
N5922_RS25030 (N5922_25025) 198970..199305 - 336 WP_000683476.1 hypothetical protein -
N5922_RS25035 (N5922_25030) 199402..199890 + 489 WP_001273096.1 DUF1643 domain-containing protein -
N5922_RS25040 (N5922_25035) 199893..200390 + 498 WP_000062185.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid floR / sul2 / blaTEM-1D / blaKPC-2 manB / manC 1..210107 210107
- flank IS/Tn - - 193820..194800 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T258999 WP_000270043.1 NZ_CP104682:c196864-196514 [Escherichia coli]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT258999 WP_000124640.1 NZ_CP104682:c196509-196207 [Escherichia coli]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References