Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 196207..196864 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104682 | ||
| Organism | Escherichia coli strain 2022CK-00450 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | N5922_RS25005 | Protein ID | WP_000270043.1 |
| Coordinates | 196514..196864 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5922_RS25000 | Protein ID | WP_000124640.1 |
| Coordinates | 196207..196509 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5922_RS24955 (N5922_24950) | 191476..191922 | + | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
| N5922_RS24960 (N5922_24955) | 191919..192437 | + | 519 | WP_000210758.1 | nitrite reductase | - |
| N5922_RS24965 (N5922_24960) | 192437..192667 | + | 231 | WP_000972663.1 | hypothetical protein | - |
| N5922_RS24970 (N5922_24965) | 192654..193511 | + | 858 | WP_001167032.1 | hypothetical protein | - |
| N5922_RS24975 (N5922_24970) | 193537..193725 | + | 189 | WP_001270411.1 | hypothetical protein | - |
| N5922_RS24980 (N5922_24975) | 193820..194800 | + | 981 | WP_012569499.1 | IS5-like element ISKpn26 family transposase | - |
| N5922_RS24985 (N5922_24980) | 194924..195469 | + | 546 | WP_032413569.1 | thermonuclease family protein | - |
| N5922_RS24990 (N5922_24985) | 195527..195799 | + | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
| N5922_RS24995 (N5922_24990) | 195887..196180 | + | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
| N5922_RS25000 (N5922_24995) | 196207..196509 | - | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| N5922_RS25005 (N5922_25000) | 196514..196864 | - | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5922_RS25010 (N5922_25005) | 197027..197575 | + | 549 | WP_001061574.1 | transcriptional regulator | - |
| N5922_RS25015 (N5922_25010) | 197916..198110 | + | 195 | WP_000343597.1 | hypothetical protein | - |
| N5922_RS25020 (N5922_25015) | 198121..198492 | + | 372 | WP_000516916.1 | hypothetical protein | - |
| N5922_RS25025 (N5922_25020) | 198485..198955 | + | 471 | WP_001281821.1 | hypothetical protein | - |
| N5922_RS25030 (N5922_25025) | 198970..199305 | - | 336 | WP_000683476.1 | hypothetical protein | - |
| N5922_RS25035 (N5922_25030) | 199402..199890 | + | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| N5922_RS25040 (N5922_25035) | 199893..200390 | + | 498 | WP_000062185.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / sul2 / blaTEM-1D / blaKPC-2 | manB / manC | 1..210107 | 210107 | |
| - | flank | IS/Tn | - | - | 193820..194800 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T258999 WP_000270043.1 NZ_CP104682:c196864-196514 [Escherichia coli]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|