Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3842822..3843516 | Replicon | chromosome |
| Accession | NZ_CP104681 | ||
| Organism | Escherichia coli strain 2022CK-00450 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | N5922_RS18980 | Protein ID | WP_001263493.1 |
| Coordinates | 3842822..3843220 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | N5922_RS18985 | Protein ID | WP_000554757.1 |
| Coordinates | 3843223..3843516 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3838482) | 3838482..3838562 | - | 81 | NuclAT_10 | - | - |
| - (3838482) | 3838482..3838562 | - | 81 | NuclAT_10 | - | - |
| - (3838482) | 3838482..3838562 | - | 81 | NuclAT_10 | - | - |
| - (3838482) | 3838482..3838562 | - | 81 | NuclAT_10 | - | - |
| N5922_RS18950 (3837822) | 3837822..3839066 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| N5922_RS18955 (3839158) | 3839158..3839616 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| N5922_RS18960 (3839877) | 3839877..3841334 | + | 1458 | WP_001293002.1 | cytosol nonspecific dipeptidase | - |
| N5922_RS18965 (3841391) | 3841391..3841912 | - | 522 | Protein_3717 | peptide chain release factor H | - |
| N5922_RS18970 (3841911) | 3841911..3842114 | - | 204 | Protein_3718 | RtcB family protein | - |
| N5922_RS18975 (3842360) | 3842360..3842812 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| N5922_RS18980 (3842822) | 3842822..3843220 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| N5922_RS18985 (3843223) | 3843223..3843516 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N5922_RS18990 (3843568) | 3843568..3844623 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| N5922_RS18995 (3844694) | 3844694..3845479 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| N5922_RS19000 (3845451) | 3845451..3847163 | + | 1713 | Protein_3724 | flagellar biosynthesis protein FlhA | - |
| N5922_RS19005 (3847379) | 3847379..3847876 | - | 498 | WP_000006261.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T258995 WP_001263493.1 NZ_CP104681:c3843220-3842822 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|