Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 767111..767804 | Replicon | chromosome |
Accession | NZ_CP104681 | ||
Organism | Escherichia coli strain 2022CK-00450 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | N5922_RS03835 | Protein ID | WP_000415584.1 |
Coordinates | 767111..767407 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | N5922_RS03840 | Protein ID | WP_000650107.1 |
Coordinates | 767409..767804 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5922_RS03800 (762199) | 762199..762513 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
N5922_RS03805 (762544) | 762544..763125 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
N5922_RS03810 (763444) | 763444..763776 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
N5922_RS03815 (763822) | 763822..765171 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
N5922_RS03820 (765168) | 765168..765827 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
N5922_RS03825 (765979) | 765979..766371 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
N5922_RS03830 (766424) | 766424..766906 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
N5922_RS03835 (767111) | 767111..767407 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
N5922_RS03840 (767409) | 767409..767804 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
N5922_RS03845 (767937) | 767937..769544 | + | 1608 | WP_222214717.1 | ABC transporter substrate-binding protein | - |
N5922_RS03850 (769682) | 769682..771940 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T258981 WP_000415584.1 NZ_CP104681:767111-767407 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT258981 WP_000650107.1 NZ_CP104681:767409-767804 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|