Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 657007..657806 | Replicon | chromosome |
| Accession | NZ_CP104681 | ||
| Organism | Escherichia coli strain 2022CK-00450 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | N5922_RS03290 | Protein ID | WP_000347251.1 |
| Coordinates | 657007..657471 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | N5922_RS03295 | Protein ID | WP_001307405.1 |
| Coordinates | 657471..657806 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5922_RS03260 (652008) | 652008..652442 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| N5922_RS03265 (652460) | 652460..653338 | - | 879 | WP_222214802.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N5922_RS03270 (653328) | 653328..654107 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N5922_RS03275 (654118) | 654118..654591 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N5922_RS03280 (654614) | 654614..655894 | - | 1281 | WP_000681905.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N5922_RS03285 (656143) | 656143..656952 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| N5922_RS03290 (657007) | 657007..657471 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N5922_RS03295 (657471) | 657471..657806 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N5922_RS03300 (657955) | 657955..659526 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| N5922_RS03305 (659901) | 659901..661235 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N5922_RS03310 (661251) | 661251..662021 | + | 771 | WP_089584629.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T258979 WP_000347251.1 NZ_CP104681:c657471-657007 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |