Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 71189..71916 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104679 | ||
| Organism | Klebsiella pneumoniae strain 2021CK-00608 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | N5933_RS26790 | Protein ID | WP_011251285.1 |
| Coordinates | 71189..71500 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5933_RS26795 | Protein ID | WP_011251286.1 |
| Coordinates | 71497..71916 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5933_RS26760 (N5933_26765) | 66380..67360 | + | 981 | WP_012569499.1 | IS5-like element ISKpn26 family transposase | - |
| N5933_RS26765 (N5933_26770) | 67906..68085 | - | 180 | Protein_75 | IS5/IS1182 family transposase | - |
| N5933_RS26770 (N5933_26775) | 68125..69663 | - | 1539 | WP_017901237.1 | IS66 family transposase | - |
| N5933_RS26775 (N5933_26780) | 69712..70059 | - | 348 | WP_032430752.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| N5933_RS26780 (N5933_26785) | 70056..70433 | - | 378 | WP_004118218.1 | transposase | - |
| N5933_RS26785 (N5933_26790) | 70547..70984 | + | 438 | Protein_79 | DDE-type integrase/transposase/recombinase | - |
| N5933_RS26790 (N5933_26795) | 71189..71500 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N5933_RS26795 (N5933_26800) | 71497..71916 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N5933_RS26800 (N5933_26805) | 71986..72399 | + | 414 | WP_017901337.1 | hypothetical protein | - |
| N5933_RS26805 (N5933_26810) | 72445..73413 | - | 969 | WP_074168518.1 | IS5-like element IS903B family transposase | - |
| N5933_RS26810 (N5933_26815) | 73517..73783 | + | 267 | WP_017900868.1 | hypothetical protein | - |
| N5933_RS26815 (N5933_26820) | 73897..74432 | - | 536 | Protein_85 | transposase | - |
| N5933_RS26820 (N5933_26825) | 74957..76324 | - | 1368 | WP_017900870.1 | formimidoylglutamate deiminase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(D) / catA1 | - | 1..210059 | 210059 | |
| - | inside | IScluster/Tn | - | - | 66380..74115 | 7735 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T258976 WP_011251285.1 NZ_CP104679:71189-71500 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT258976 WP_011251286.1 NZ_CP104679:71497-71916 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|