Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4613461..4614047 Replicon chromosome
Accession NZ_CP104678
Organism Klebsiella pneumoniae strain 2021CK-00608

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag N5933_RS22555 Protein ID WP_002920800.1
Coordinates 4613461..4613829 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag N5933_RS22560 Protein ID WP_004174006.1
Coordinates 4613826..4614047 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5933_RS22535 (4608964) 4608964..4610034 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
N5933_RS22540 (4610036) 4610036..4610881 - 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N5933_RS22545 (4610878) 4610878..4611765 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N5933_RS22550 (4611872) 4611872..4613188 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N5933_RS22555 (4613461) 4613461..4613829 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N5933_RS22560 (4613826) 4613826..4614047 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N5933_RS22565 (4614211) 4614211..4614924 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N5933_RS22570 (4614926) 4614926..4615693 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N5933_RS22575 (4615690) 4615690..4616967 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
N5933_RS22580 (4616964) 4616964..4617890 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4608227..4615693 7466


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T258970 WP_002920800.1 NZ_CP104678:c4613829-4613461 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT258970 WP_004174006.1 NZ_CP104678:c4614047-4613826 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References