Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3964337..3964934 | Replicon | chromosome |
Accession | NZ_CP104678 | ||
Organism | Klebsiella pneumoniae strain 2021CK-00608 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | N5933_RS19515 | Protein ID | WP_004142563.1 |
Coordinates | 3964617..3964934 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | N5933_RS19510 | Protein ID | WP_004142561.1 |
Coordinates | 3964337..3964624 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5933_RS19480 (3960417) | 3960417..3960665 | + | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
N5933_RS19485 (3960683) | 3960683..3961024 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
N5933_RS19490 (3961055) | 3961055..3962170 | - | 1116 | WP_020325248.1 | MBL fold metallo-hydrolase | - |
N5933_RS19495 (3962350) | 3962350..3962931 | + | 582 | WP_020325240.1 | TetR/AcrR family transcriptional regulator | - |
N5933_RS19500 (3962931) | 3962931..3963299 | + | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
N5933_RS19505 (3963419) | 3963419..3964072 | + | 654 | WP_117040415.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
N5933_RS19510 (3964337) | 3964337..3964624 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N5933_RS19515 (3964617) | 3964617..3964934 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5933_RS19520 (3965119) | 3965119..3966162 | - | 1044 | WP_020325241.1 | DUF2157 domain-containing protein | - |
N5933_RS19525 (3966832) | 3966832..3967698 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
N5933_RS19530 (3967807) | 3967807..3969234 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T258968 WP_004142563.1 NZ_CP104678:c3964934-3964617 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |