Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4562564..4563318 | Replicon | chromosome |
| Accession | NZ_CP104677 | ||
| Organism | Salmonella enterica strain PNUSAS036471 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | N4534_RS22205 | Protein ID | WP_000558166.1 |
| Coordinates | 4562564..4562875 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4534_RS22210 | Protein ID | WP_001259011.1 |
| Coordinates | 4562872..4563318 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4534_RS22175 (4558222) | 4558222..4559124 | + | 903 | WP_000331365.1 | formate dehydrogenase subunit beta | - |
| N4534_RS22180 (4559121) | 4559121..4559756 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N4534_RS22185 (4559753) | 4559753..4560682 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| N4534_RS22190 (4560729) | 4560729..4561019 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| N4534_RS22195 (4561020) | 4561020..4561331 | - | 312 | WP_001159632.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| N4534_RS22200 (4561549) | 4561549..4562478 | + | 930 | WP_001127702.1 | alpha/beta hydrolase | - |
| N4534_RS22205 (4562564) | 4562564..4562875 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N4534_RS22210 (4562872) | 4562872..4563318 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| N4534_RS22215 (4563333) | 4563333..4564273 | - | 941 | Protein_4337 | fatty acid biosynthesis protein FabY | - |
| N4534_RS22220 (4564318) | 4564318..4564755 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| N4534_RS22225 (4564752) | 4564752..4565624 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| N4534_RS22230 (4565618) | 4565618..4566217 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| N4534_RS22235 (4566408) | 4566408..4567211 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| N4534_RS22240 (4567245) | 4567245..4568141 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T258959 WP_000558166.1 NZ_CP104677:4562564-4562875 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT258959 WP_001259011.1 NZ_CP104677:4562872-4563318 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|