Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 29906..30618 | Replicon | plasmid unnamed2 |
Accession | NZ_CP104667 | ||
Organism | Escherichia coli strain 2021CK-00607 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N5914_RS25570 | Protein ID | WP_097452654.1 |
Coordinates | 29906..30208 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5914_RS25575 | Protein ID | WP_000806445.1 |
Coordinates | 30280..30618 (+) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5914_RS25545 (N5914_25555) | 25564..26469 | - | 906 | WP_021551813.1 | recombination-associated protein RdgC | - |
N5914_RS25550 (N5914_25560) | 26529..27206 | - | 678 | WP_016262377.1 | hypothetical protein | - |
N5914_RS25555 (N5914_25565) | 27203..28183 | - | 981 | WP_094545091.1 | tail length tape measure protein | - |
N5914_RS25560 (N5914_25570) | 28187..28954 | - | 768 | WP_094545090.1 | baseplate | - |
N5914_RS25565 (N5914_25575) | 28951..29742 | - | 792 | WP_016262380.1 | hypothetical protein | - |
N5914_RS25570 (N5914_25580) | 29906..30208 | + | 303 | WP_097452654.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5914_RS25575 (N5914_25585) | 30280..30618 | + | 339 | WP_000806445.1 | HigA family addiction module antitoxin | Antitoxin |
N5914_RS25580 (N5914_25590) | 30675..31034 | + | 360 | WP_097452653.1 | transcriptional regulator | - |
N5914_RS25585 (N5914_25595) | 31096..31833 | + | 738 | WP_261629118.1 | hypothetical protein | - |
N5914_RS25590 (N5914_25600) | 31867..33063 | - | 1197 | WP_097765456.1 | phage tail protein | - |
N5914_RS25595 (N5914_25605) | 33056..33385 | - | 330 | WP_016262385.1 | hypothetical protein | - |
N5914_RS25600 (N5914_25610) | 33717..34370 | - | 654 | WP_021551806.1 | hypothetical protein | - |
N5914_RS25605 (N5914_25615) | 34495..35259 | + | 765 | WP_236938445.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..91750 | 91750 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11958.75 Da Isoelectric Point: 10.0208
>T258941 WP_097452654.1 NZ_CP104667:29906-30208 [Escherichia coli]
MNKKINIKNFRDEWLDDFFEFSIPHKKIPSDIQITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNKQYR
LIFKWVNGKAEDLYLDPHKY
MNKKINIKNFRDEWLDDFFEFSIPHKKIPSDIQITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNKQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|