Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 43300..43554 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104666 | ||
| Organism | Escherichia coli strain 2021CK-00607 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A1D7QA06 |
| Locus tag | N5914_RS24930 | Protein ID | WP_001367749.1 |
| Coordinates | 43300..43449 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 43493..43554 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5914_RS24895 (38659) | 38659..39074 | - | 416 | Protein_51 | IS1 family transposase | - |
| N5914_RS24900 (39323) | 39323..39724 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| N5914_RS24905 (39657) | 39657..39914 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| N5914_RS24910 (40007) | 40007..40660 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| N5914_RS24915 (41599) | 41599..42456 | - | 858 | WP_029702152.1 | incFII family plasmid replication initiator RepA | - |
| N5914_RS24920 (42449) | 42449..42523 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| N5914_RS24925 (42759) | 42759..43016 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| N5914_RS24930 (43300) | 43300..43449 | - | 150 | WP_001367749.1 | Hok/Gef family protein | Toxin |
| - (43493) | 43493..43554 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (43493) | 43493..43554 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (43493) | 43493..43554 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (43493) | 43493..43554 | + | 62 | NuclAT_0 | - | Antitoxin |
| N5914_RS24935 (43693) | 43693..44121 | - | 429 | WP_029702151.1 | hypothetical protein | - |
| N5914_RS24940 (44334) | 44334..44903 | - | 570 | WP_029702150.1 | DUF2726 domain-containing protein | - |
| N5914_RS24945 (45055) | 45055..45681 | - | 627 | WP_029702149.1 | NYN domain-containing protein | - |
| N5914_RS24950 (46093) | 46093..46302 | - | 210 | WP_039023209.1 | hypothetical protein | - |
| N5914_RS24955 (46433) | 46433..46993 | - | 561 | WP_001567328.1 | fertility inhibition protein FinO | - |
| N5914_RS24960 (47048) | 47048..47794 | - | 747 | WP_052273601.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaTEM-1B / erm(B) / dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / mph(A) / aadA5 / tet(B) | - | 1..131846 | 131846 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5528.64 Da Isoelectric Point: 8.7678
>T258936 WP_001367749.1 NZ_CP104666:c43449-43300 [Escherichia coli]
MTKYALIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT258936 NZ_CP104666:43493-43554 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|