Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
Location | 4329519..4329931 | Replicon | chromosome |
Accession | NZ_CP104665 | ||
Organism | Escherichia coli strain 2021CK-00607 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | N5914_RS20850 | Protein ID | WP_000132601.1 |
Coordinates | 4329590..4329931 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 4329519..4329595 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5914_RS20840 (4326382) | 4326382..4327971 | + | 1590 | WP_001063200.1 | type I restriction-modification system methyltransferase | - |
N5914_RS20845 (4327968) | 4327968..4329362 | + | 1395 | WP_001272445.1 | type I restriction-modification system specificity subunit | - |
- (4329519) | 4329519..4329595 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4329519) | 4329519..4329595 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4329519) | 4329519..4329595 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4329519) | 4329519..4329595 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4329519) | 4329519..4329595 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4329519) | 4329519..4329595 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4329519) | 4329519..4329595 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4329519) | 4329519..4329595 | - | 77 | NuclAT_8 | - | Antitoxin |
N5914_RS20850 (4329590) | 4329590..4329931 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
N5914_RS20855 (4330093) | 4330093..4331472 | + | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
N5914_RS20860 (4331472) | 4331472..4332518 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T258928 WP_000132601.1 NZ_CP104665:4329590-4329931 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT258928 NZ_CP104665:c4329595-4329519 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|