Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3972571..3973265 | Replicon | chromosome |
Accession | NZ_CP104665 | ||
Organism | Escherichia coli strain 2021CK-00607 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q0T7Q5 |
Locus tag | N5914_RS19175 | Protein ID | WP_001263491.1 |
Coordinates | 3972571..3972969 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | L4JHF0 |
Locus tag | N5914_RS19180 | Protein ID | WP_000554755.1 |
Coordinates | 3972972..3973265 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5914_RS19145 (3967833) | 3967833..3969290 | + | 1458 | WP_022645227.1 | cytosol nonspecific dipeptidase | - |
N5914_RS19150 (3969299) | 3969299..3969580 | + | 282 | WP_022645226.1 | hypothetical protein | - |
N5914_RS19155 (3969597) | 3969597..3970106 | - | 510 | WP_001361775.1 | metal-dependent hydrolase | - |
N5914_RS19160 (3970168) | 3970168..3970782 | - | 615 | WP_022645225.1 | peptide chain release factor H | - |
N5914_RS19165 (3970779) | 3970779..3971918 | - | 1140 | WP_022645224.1 | RNA ligase RtcB family protein | - |
N5914_RS19170 (3972109) | 3972109..3972561 | - | 453 | WP_023909048.1 | GNAT family N-acetyltransferase | - |
N5914_RS19175 (3972571) | 3972571..3972969 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
N5914_RS19180 (3972972) | 3972972..3973265 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
N5914_RS19185 (3973317) | 3973317..3974372 | - | 1056 | WP_022645222.1 | DNA polymerase IV | - |
N5914_RS19190 (3974443) | 3974443..3975228 | - | 786 | WP_072224360.1 | putative lateral flagellar export/assembly protein LafU | - |
N5914_RS19195 (3975200) | 3975200..3976912 | + | 1713 | Protein_3765 | flagellar biosynthesis protein FlhA | - |
N5914_RS19200 (3977010) | 3977010..3977783 | - | 774 | WP_022645219.1 | C40 family peptidase | - |
N5914_RS19205 (3977969) | 3977969..3978229 | + | 261 | WP_000729708.1 | type II toxin-antitoxin system antitoxin DinJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T258926 WP_001263491.1 NZ_CP104665:c3972969-3972571 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G9H5 |