Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3747275..3747954 | Replicon | chromosome |
| Accession | NZ_CP104665 | ||
| Organism | Escherichia coli strain 2021CK-00607 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A0A1A1R1 |
| Locus tag | N5914_RS18120 | Protein ID | WP_000057541.1 |
| Coordinates | 3747652..3747954 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | N5914_RS18115 | Protein ID | WP_000806442.1 |
| Coordinates | 3747275..3747616 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5914_RS18105 (3743518) | 3743518..3744450 | - | 933 | WP_022645289.1 | glutaminase A | - |
| N5914_RS18110 (3744713) | 3744713..3747217 | + | 2505 | WP_022645288.1 | copper-exporting P-type ATPase CopA | - |
| N5914_RS18115 (3747275) | 3747275..3747616 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| N5914_RS18120 (3747652) | 3747652..3747954 | - | 303 | WP_000057541.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5914_RS18125 (3748087) | 3748087..3748881 | + | 795 | WP_022645287.1 | TraB/GumN family protein | - |
| N5914_RS18130 (3749085) | 3749085..3749564 | + | 480 | WP_000186638.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| N5914_RS18135 (3749601) | 3749601..3751253 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| N5914_RS18140 (3751471) | 3751471..3752691 | + | 1221 | WP_022645286.1 | fosmidomycin MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11795.37 Da Isoelectric Point: 10.2638
>T258924 WP_000057541.1 NZ_CP104665:c3747954-3747652 [Escherichia coli]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1A1R1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2EBY | |
| AlphaFold DB | S1QAY3 |