Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3976270..3976867 | Replicon | chromosome |
Accession | NZ_CP104660 | ||
Organism | Klebsiella pneumoniae strain 2021CK-01729 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | N4T33_RS19150 | Protein ID | WP_004142563.1 |
Coordinates | 3976550..3976867 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | N4T33_RS19145 | Protein ID | WP_004142561.1 |
Coordinates | 3976270..3976557 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T33_RS19115 (N4T33_19120) | 3972350..3972598 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
N4T33_RS19120 (N4T33_19125) | 3972616..3972957 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
N4T33_RS19125 (N4T33_19130) | 3972988..3974103 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
N4T33_RS19130 (N4T33_19135) | 3974283..3974864 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
N4T33_RS19135 (N4T33_19140) | 3974864..3975232 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
N4T33_RS19140 (N4T33_19145) | 3975352..3976005 | + | 654 | WP_019704893.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
N4T33_RS19145 (N4T33_19150) | 3976270..3976557 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N4T33_RS19150 (N4T33_19155) | 3976550..3976867 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4T33_RS19155 (N4T33_19160) | 3977052..3978095 | - | 1044 | WP_019704892.1 | DUF2157 domain-containing protein | - |
N4T33_RS19160 (N4T33_19165) | 3978765..3979631 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
N4T33_RS19165 (N4T33_19170) | 3979740..3981167 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T258904 WP_004142563.1 NZ_CP104660:c3976867-3976550 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |