Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3631121..3631707 Replicon chromosome
Accession NZ_CP104659
Organism Klebsiella pneumoniae strain 2020CK-00096

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag N5936_RS17830 Protein ID WP_002920800.1
Coordinates 3631121..3631489 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag N5936_RS17835 Protein ID WP_004174006.1
Coordinates 3631486..3631707 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5936_RS17810 (3626624) 3626624..3627694 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
N5936_RS17815 (3627696) 3627696..3628541 - 846 WP_032434559.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N5936_RS17820 (3628538) 3628538..3629425 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N5936_RS17825 (3629532) 3629532..3630848 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N5936_RS17830 (3631121) 3631121..3631489 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N5936_RS17835 (3631486) 3631486..3631707 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N5936_RS17840 (3631871) 3631871..3632584 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N5936_RS17845 (3632586) 3632586..3633353 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N5936_RS17850 (3633350) 3633350..3634627 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
N5936_RS17855 (3634624) 3634624..3635550 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3625887..3634627 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T258889 WP_002920800.1 NZ_CP104659:c3631489-3631121 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT258889 WP_004174006.1 NZ_CP104659:c3631707-3631486 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References