Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3604882..3605528 | Replicon | chromosome |
| Accession | NZ_CP104659 | ||
| Organism | Klebsiella pneumoniae strain 2020CK-00096 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | W9BBY1 |
| Locus tag | N5936_RS17720 | Protein ID | WP_016529833.1 |
| Coordinates | 3605181..3605528 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | W8UB68 |
| Locus tag | N5936_RS17715 | Protein ID | WP_002920557.1 |
| Coordinates | 3604882..3605181 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5936_RS17695 (3601088) | 3601088..3601846 | - | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
| N5936_RS17700 (3601896) | 3601896..3602726 | - | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| N5936_RS17705 (3602777) | 3602777..3603106 | - | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| N5936_RS17710 (3603311) | 3603311..3604819 | + | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| N5936_RS17715 (3604882) | 3604882..3605181 | - | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| N5936_RS17720 (3605181) | 3605181..3605528 | - | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5936_RS17725 (3605694) | 3605694..3608141 | - | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| N5936_RS17730 (3608159) | 3608159..3609592 | - | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T258888 WP_016529833.1 NZ_CP104659:c3605528-3605181 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W9BBY1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1CBF8 |