Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 1425210..1425899 | Replicon | chromosome |
Accession | NZ_CP104659 | ||
Organism | Klebsiella pneumoniae strain 2020CK-00096 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | N5936_RS06965 | Protein ID | WP_021469727.1 |
Coordinates | 1425210..1425527 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6B0N7G3 |
Locus tag | N5936_RS06970 | Protein ID | WP_020804705.1 |
Coordinates | 1425603..1425899 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5936_RS06935 (1420912) | 1420912..1421421 | + | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
N5936_RS06940 (1421431) | 1421431..1422357 | + | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
N5936_RS06945 (1422341) | 1422341..1423120 | + | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
N5936_RS06950 (1423159) | 1423159..1424010 | + | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
N5936_RS06955 (1424088) | 1424088..1424705 | + | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
N5936_RS06960 (1424776) | 1424776..1425003 | + | 228 | WP_002906690.1 | tautomerase PptA | - |
N5936_RS06965 (1425210) | 1425210..1425527 | + | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5936_RS06970 (1425603) | 1425603..1425899 | + | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
N5936_RS06975 (1425978) | 1425978..1426424 | + | 447 | WP_032435212.1 | hypothetical protein | - |
N5936_RS06980 (1426465) | 1426465..1428081 | - | 1617 | WP_004175961.1 | carbohydrate porin | - |
N5936_RS06985 (1428125) | 1428125..1429507 | - | 1383 | WP_004151222.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T258885 WP_021469727.1 NZ_CP104659:1425210-1425527 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331C6E2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0N7G3 |