Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4570312..4571006 | Replicon | chromosome |
Accession | NZ_CP104649 | ||
Organism | Escherichia coli strain PNUSAE008512 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | C3TNX7 |
Locus tag | N5913_RS23115 | Protein ID | WP_001263495.1 |
Coordinates | 4570608..4571006 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | N5913_RS23110 | Protein ID | WP_000554757.1 |
Coordinates | 4570312..4570605 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5913_RS23090 (4566023) | 4566023..4566520 | + | 498 | Protein_4503 | REP-associated tyrosine transposase RayT | - |
N5913_RS23095 (4566665) | 4566665..4568377 | - | 1713 | Protein_4504 | flagellar biosynthesis protein FlhA | - |
N5913_RS23100 (4568349) | 4568349..4569134 | + | 786 | WP_000207556.1 | putative lateral flagellar export/assembly protein LafU | - |
N5913_RS23105 (4569205) | 4569205..4570260 | + | 1056 | WP_001226186.1 | DNA polymerase IV | - |
N5913_RS23110 (4570312) | 4570312..4570605 | + | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
N5913_RS23115 (4570608) | 4570608..4571006 | + | 399 | WP_001263495.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
N5913_RS23120 (4571016) | 4571016..4571468 | + | 453 | WP_001059871.1 | GNAT family N-acetyltransferase | - |
N5913_RS23125 (4571787) | 4571787..4571990 | + | 204 | Protein_4510 | RtcB family protein | - |
N5913_RS23130 (4571989) | 4571989..4572510 | + | 522 | Protein_4511 | peptide chain release factor H | - |
N5913_RS23135 (4572567) | 4572567..4574024 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
N5913_RS23140 (4574285) | 4574285..4574743 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (4575339) | 4575339..4575419 | + | 81 | NuclAT_11 | - | - |
- (4575339) | 4575339..4575419 | + | 81 | NuclAT_11 | - | - |
- (4575339) | 4575339..4575419 | + | 81 | NuclAT_11 | - | - |
- (4575339) | 4575339..4575419 | + | 81 | NuclAT_11 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15473.86 Da Isoelectric Point: 8.0949
>T258869 WP_001263495.1 NZ_CP104649:4570608-4571006 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|