Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
| Location | 4216729..4217141 | Replicon | chromosome |
| Accession | NZ_CP104649 | ||
| Organism | Escherichia coli strain PNUSAE008512 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | Q8FA88 |
| Locus tag | N5913_RS21495 | Protein ID | WP_000132630.1 |
| Coordinates | 4216729..4217070 (-) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 4217065..4217141 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5913_RS21475 (4212740) | 4212740..4214152 | - | 1413 | WP_000199295.1 | PLP-dependent aminotransferase family protein | - |
| N5913_RS21480 (4214329) | 4214329..4214493 | + | 165 | WP_000394274.1 | DUF1127 domain-containing protein | - |
| N5913_RS21485 (4214590) | 4214590..4215471 | + | 882 | WP_001304007.1 | DUF262 domain-containing protein | - |
| N5913_RS21490 (4215519) | 4215519..4216682 | + | 1164 | WP_001304006.1 | DUF1524 domain-containing protein | - |
| N5913_RS21495 (4216729) | 4216729..4217070 | - | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
| - (4217065) | 4217065..4217141 | + | 77 | NuclAT_14 | - | Antitoxin |
| - (4217065) | 4217065..4217141 | + | 77 | NuclAT_14 | - | Antitoxin |
| - (4217065) | 4217065..4217141 | + | 77 | NuclAT_14 | - | Antitoxin |
| - (4217065) | 4217065..4217141 | + | 77 | NuclAT_14 | - | Antitoxin |
| - (4217065) | 4217065..4217141 | + | 77 | NuclAT_15 | - | Antitoxin |
| - (4217065) | 4217065..4217141 | + | 77 | NuclAT_15 | - | Antitoxin |
| - (4217065) | 4217065..4217141 | + | 77 | NuclAT_15 | - | Antitoxin |
| - (4217065) | 4217065..4217141 | + | 77 | NuclAT_15 | - | Antitoxin |
| N5913_RS21500 (4217291) | 4217291..4219045 | - | 1755 | WP_000110082.1 | restriction endonuclease subunit S | - |
| N5913_RS21505 (4219045) | 4219045..4220514 | - | 1470 | WP_001302468.1 | type I restriction-modification system subunit M | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 4206222..4224942 | 18720 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T258864 WP_000132630.1 NZ_CP104649:c4217070-4216729 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT258864 NZ_CP104649:4217065-4217141 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|