Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2782455..2783182 | Replicon | chromosome |
Accession | NZ_CP104649 | ||
Organism | Escherichia coli strain PNUSAE008512 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | N5913_RS14650 | Protein ID | WP_000550189.1 |
Coordinates | 2782868..2783182 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5913_RS14645 | Protein ID | WP_000560249.1 |
Coordinates | 2782455..2782871 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5913_RS14635 (2777515) | 2777515..2779866 | + | 2352 | WP_000695517.1 | alpha-glucosidase | - |
N5913_RS14640 (2780392) | 2780392..2782410 | + | 2019 | WP_000121479.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
N5913_RS14645 (2782455) | 2782455..2782871 | - | 417 | WP_000560249.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
N5913_RS14650 (2782868) | 2782868..2783182 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
N5913_RS14655 (2783466) | 2783466..2784602 | - | 1137 | WP_000018678.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
N5913_RS14660 (2784687) | 2784687..2785190 | + | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
N5913_RS14665 (2785267) | 2785267..2785959 | + | 693 | WP_000942543.1 | vancomycin high temperature exclusion protein | - |
N5913_RS14670 (2786038) | 2786038..2787024 | + | 987 | WP_000617675.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T258855 WP_000550189.1 NZ_CP104649:c2783182-2782868 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15016.48 Da Isoelectric Point: 4.5805
>AT258855 WP_000560249.1 NZ_CP104649:c2782871-2782455 [Escherichia coli]
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|