Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 5005258..5005483 | Replicon | chromosome |
| Accession | NZ_CP104647 | ||
| Organism | Escherichia coli strain PNUSAE008406 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | N5921_RS24865 | Protein ID | WP_000813258.1 |
| Coordinates | 5005258..5005413 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 5005425..5005483 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5921_RS24815 | 5000260..5000691 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
| N5921_RS24830 | 5001142..5001855 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| N5921_RS24835 | 5001991..5002188 | - | 198 | WP_000917763.1 | hypothetical protein | - |
| N5921_RS24840 | 5002413..5002967 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
| N5921_RS24845 | 5003030..5003335 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| N5921_RS24850 | 5003348..5004398 | - | 1051 | Protein_4844 | DUF968 domain-containing protein | - |
| N5921_RS24855 | 5004400..5004672 | - | 273 | WP_000191872.1 | hypothetical protein | - |
| N5921_RS24860 | 5004794..5005138 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| N5921_RS24865 | 5005258..5005413 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
| - | 5005425..5005483 | + | 59 | - | - | Antitoxin |
| N5921_RS24870 | 5005704..5006261 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| N5921_RS24875 | 5006263..5006481 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
| N5921_RS24880 | 5006609..5006920 | - | 312 | WP_001289673.1 | hypothetical protein | - |
| N5921_RS24885 | 5006913..5007140 | - | 228 | WP_000699809.1 | hypothetical protein | - |
| N5921_RS24890 | 5007137..5007418 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
| N5921_RS24895 | 5007451..5008167 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| N5921_RS24900 | 5008201..5008662 | - | 462 | WP_000139447.1 | replication protein P | - |
| N5921_RS24905 | 5008655..5009698 | - | 1044 | WP_001262402.1 | DnaT-like ssDNA-binding domain-containing protein | - |
| N5921_RS24910 | 5009767..5010192 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
| N5921_RS24915 | 5010176..5010418 | - | 243 | WP_000747948.1 | Cro/CI family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 4974807..5073871 | 99064 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T258836 WP_000813258.1 NZ_CP104647:c5005413-5005258 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT258836 NZ_CP104647:5005425-5005483 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
