Detailed information of TA system TA258834

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 4585801..4586015
• Replicon: chromosome
• Accession: NZ_CP104647
• Organism: Escherichia coli strain PNUSAE008406

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: N5921_RS22735
• Protein ID: WP_000170963.1
• Coordinates: 4585801..4585908 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	4585956..4586015 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N5921_RS22705 (4581110)	4581110..4582192	+	1083	WP_000804726.1	peptide chain release factor 1	-
N5921_RS22710 (4582192)	4582192..4583025	+	834	WP_000456466.1	peptide chain release factor N(5)-glutamine methyltransferase	-
N5921_RS22715 (4583022)	4583022..4583414	+	393	WP_000200379.1	invasion regulator SirB2	-
N5921_RS22720 (4583418)	4583418..4584227	+	810	WP_001257044.1	invasion regulator SirB1	-
N5921_RS22725 (4584263)	4584263..4585117	+	855	WP_000811067.1	3-deoxy-8-phosphooctulonate synthase	-
N5921_RS22730 (4585265)	4585265..4585372	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
- (4585425)	4585425..4585486	+	62	NuclAT_24	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_24	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_24	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_24	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_26	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_26	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_26	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_26	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_28	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_28	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_28	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_28	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_30	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_30	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_30	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_30	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_32	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_32	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_32	-	-
- (4585425)	4585425..4585486	+	62	NuclAT_32	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_17	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_17	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_17	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_17	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_18	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_18	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_18	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_18	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_19	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_19	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_19	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_19	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_20	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_20	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_20	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_20	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_22	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_22	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_22	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_22	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_23	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_23	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_23	-	-
- (4585425)	4585425..4585487	+	63	NuclAT_23	-	-
N5921_RS22735 (4585801)	4585801..4585908	-	108	WP_000170963.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (4585956)	4585956..4586015	+	60	NuclAT_25	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_25	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_25	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_25	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_27	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_27	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_27	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_27	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_29	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_29	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_29	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_29	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_31	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_31	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_31	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_31	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_33	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_33	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_33	-	Antitoxin
- (4585956)	4585956..4586015	+	60	NuclAT_33	-	Antitoxin
N5921_RS22740 (4586307)	4586307..4587407	-	1101	WP_001301956.1	sodium-potassium/proton antiporter ChaA	-
N5921_RS22745 (4587677)	4587677..4587907	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
N5921_RS22750 (4588068)	4588068..4588763	+	696	WP_001301489.1	glutathione-specific gamma-glutamylcyclotransferase	-
N5921_RS22755 (4588807)	4588807..4589160	-	354	WP_001169661.1	DsrE/F sulfur relay family protein YchN	-
N5921_RS22760 (4589346)	4589346..4590740	+	1395	WP_000086192.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T258834 WP_000170963.1 NZ_CP104647:c4585908-4585801 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 60 bp

>AT258834 NZ_CP104647:4585956-4586015 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin