Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4128001..4128226 | Replicon | chromosome |
Accession | NZ_CP104647 | ||
Organism | Escherichia coli strain PNUSAE008406 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | N5921_RS20160 | Protein ID | WP_000813263.1 |
Coordinates | 4128071..4128226 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 4128001..4128059 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5921_RS20130 | 4123270..4124367 | + | 1098 | WP_001475117.1 | hypothetical protein | - |
N5921_RS20135 | 4124374..4125120 | + | 747 | WP_000788745.1 | ATP-binding protein | - |
N5921_RS20140 | 4125142..4125912 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
N5921_RS20145 | 4125928..4126341 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
N5921_RS20150 | 4126693..4127466 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
N5921_RS20155 | 4127728..4127811 | + | 84 | Protein_3919 | ORF6N domain-containing protein | - |
- | 4128001..4128059 | - | 59 | - | - | Antitoxin |
N5921_RS20160 | 4128071..4128226 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
N5921_RS20165 | 4128394..4128672 | + | 279 | WP_001341388.1 | hypothetical protein | - |
N5921_RS20170 | 4128674..4129723 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
N5921_RS20175 | 4129736..4130107 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
N5921_RS20180 | 4130097..4130468 | + | 372 | WP_000090264.1 | antiterminator Q family protein | - |
N5921_RS20185 | 4130620..4131438 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
N5921_RS20190 | 4131725..4131921 | + | 197 | Protein_3926 | TrmB family transcriptional regulator | - |
N5921_RS20195 | 4132059..4132772 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T258832 WP_000813263.1 NZ_CP104647:4128071-4128226 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT258832 NZ_CP104647:c4128059-4128001 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|