Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3240899..3241593 | Replicon | chromosome |
| Accession | NZ_CP104647 | ||
| Organism | Escherichia coli strain PNUSAE008406 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | C3TNX7 |
| Locus tag | N5921_RS15995 | Protein ID | WP_001263495.1 |
| Coordinates | 3241195..3241593 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | N5921_RS15990 | Protein ID | WP_000554757.1 |
| Coordinates | 3240899..3241192 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5921_RS15970 (3236610) | 3236610..3237107 | + | 498 | Protein_3099 | REP-associated tyrosine transposase RayT | - |
| N5921_RS15975 (3237252) | 3237252..3238964 | - | 1713 | Protein_3100 | flagellar biosynthesis protein FlhA | - |
| N5921_RS15980 (3238936) | 3238936..3239721 | + | 786 | WP_000207556.1 | putative lateral flagellar export/assembly protein LafU | - |
| N5921_RS15985 (3239792) | 3239792..3240847 | + | 1056 | WP_001226186.1 | DNA polymerase IV | - |
| N5921_RS15990 (3240899) | 3240899..3241192 | + | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N5921_RS15995 (3241195) | 3241195..3241593 | + | 399 | WP_001263495.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| N5921_RS16000 (3241603) | 3241603..3242055 | + | 453 | WP_001059871.1 | GNAT family N-acetyltransferase | - |
| N5921_RS16005 (3242374) | 3242374..3242577 | + | 204 | Protein_3106 | RtcB family protein | - |
| N5921_RS16010 (3242576) | 3242576..3243097 | + | 522 | Protein_3107 | peptide chain release factor H | - |
| N5921_RS16015 (3243154) | 3243154..3244611 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| N5921_RS16020 (3244872) | 3244872..3245330 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (3245926) | 3245926..3246006 | + | 81 | NuclAT_11 | - | - |
| - (3245926) | 3245926..3246006 | + | 81 | NuclAT_11 | - | - |
| - (3245926) | 3245926..3246006 | + | 81 | NuclAT_11 | - | - |
| - (3245926) | 3245926..3246006 | + | 81 | NuclAT_11 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15473.86 Da Isoelectric Point: 8.0949
>T258828 WP_001263495.1 NZ_CP104647:3241195-3241593 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|